KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_730Help
Entry
ECTR2_730         CDS       T01887                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805283..806023
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQVENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaattaccaaaacctttcttttttgaagaaggcaaacgtgccgtgttatta
ttacatggatttacaggcaattcgtctgatgtacgtcaattaggtcgatttttacaaaaa
aagggatatacttcgtatgcaccacaatatgaaggtcacgcggcaccaccagaggaaata
ctgaaatctagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgttgctggtctatcattaggtggggattttgcttta
aaattaagcttaaatagagatgtaaagggtattgtaacgatgtgtgcaccaatgggtggc
aaaactgaaggtgccatttatgaaggctttttagagtatgcacgtaattttaaaaagtat
gaaggtaaaaatcaagagactattgataatgaaatggatcattttaaaccaactgaaact
ttaaaagaactaagtgaagcattagatacgattaaagatcaagttgatgaggtatttgac
ccaattttagtgattcaagtagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaagacatcaagtggtatagtcaatcaggacat
gttattacgattgataaagaaaaagaacaagtatttgaagatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system