KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_0453Help
Entry
ST398NM01_0453    CDS       T02043                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST398NM01_0453
   01230 Biosynthesis of amino acids
    ST398NM01_0453
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST398NM01_0453
  Energy metabolism
   00680 Methane metabolism
    ST398NM01_0453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST398NM01_0453
Enzymes [BR:sud01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ST398NM01_0453
Exosome [BR:sud04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ST398NM01_0453
  Exosomal proteins of melanoma cells
   ST398NM01_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
365496..366092
Genome map
AA seq 198 aa AA seqDB search
MRSNIMTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTETGTKSADDLCDYFKEKQIKHV
YVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFK
DFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVS
REEAVDLKVENCKPYIIE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaggagtaatattatgacgatttatttagttagacatggcgaatcaaaatcgaattat
gataataaacattttcgatcttatttttgtggacaattagatgtgccgttaacggaaact
ggcacaaaaagtgcagacgatttatgtgattattttaaagagaaacagattaaacatgta
tatgtttcagacttattaagaacacagcaaacgtttgagcatatttttccatatgacatt
gcatcaacgactacgcctctattaagagaacgttcacttggcgtatttgagggtgaatat
aaagatgaaatcagtgcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaa
gactttcgtcatagtttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatat
caacgcgtagaacattttatgaatcatgttgtcaatgaagatacacaaaaagatgatatt
gttattgttgcacatcaagttgtcattcgttgtttaatggtttattttaataacgtttca
cgggaagaagctgtggatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system