KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_0453Help
Entry
ST398NM01_0453    CDS       T02043                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00010  Glycolysis / Gluconeogenesis
sud00260  Glycine, serine and threonine metabolism
sud00680  Methane metabolism
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
sud01200  Carbon metabolism
sud01230  Biosynthesis of amino acids
Module
sud_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sud_M00002  Glycolysis, core module involving three-carbon compounds
sud_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST398NM01_0453
  Energy metabolism
   00680 Methane metabolism
    ST398NM01_0453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST398NM01_0453
Enzymes [BR:sud01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ST398NM01_0453
Membrane trafficking [BR:sud04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ST398NM01_0453
Exosome [BR:sud04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ST398NM01_0453
  Exosomal proteins of melanoma cells
   ST398NM01_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFH68694
UniProt: A0A0E0VLV0
Position
365496..366092
Genome map
AA seq 198 aa AA seqDB search
MRSNIMTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTETGTKSADDLCDYFKEKQIKHV
YVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFK
DFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVS
REEAVDLKVENCKPYIIE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaggagtaatattatgacgatttatttagttagacatggcgaatcaaaatcgaattat
gataataaacattttcgatcttatttttgtggacaattagatgtgccgttaacggaaact
ggcacaaaaagtgcagacgatttatgtgattattttaaagagaaacagattaaacatgta
tatgtttcagacttattaagaacacagcaaacgtttgagcatatttttccatatgacatt
gcatcaacgactacgcctctattaagagaacgttcacttggcgtatttgagggtgaatat
aaagatgaaatcagtgcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaa
gactttcgtcatagtttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatat
caacgcgtagaacattttatgaatcatgttgtcaatgaagatacacaaaaagatgatatt
gttattgttgcacatcaagttgtcattcgttgtttaatggtttattttaataacgtttca
cgggaagaagctgtggatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system