KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_0561Help
Entry
ST398NM01_0561    CDS       T02043                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sud00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467370..468218
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDQKIVVEIEHNYVP
SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFNIGA
SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
KLINLDKRYDVHTKMCYEALENRNYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcaccagccaaaattaattttacgctcgatacactttttaaaaga
aatgatggctatcatgagattgaaatgataatgacaacagttgatttaaatgatcgttta
actttccataaaagaaaagatcaaaagatagttgttgagattgaacataattatgtgcct
tctaatcataaaaatctcgcatatcgtgcagcgcaactatttattgagcaatatcaacta
aagcaaggtgtaacaatttctatcgataaagaaatacctgtttctgctggcttagctgga
ggttcggctgatgcagcagcaacgttgagaggattgaatcgactttttaatataggggcg
agtttggaagaattggctctactaggcagtaaaatcgggacagatattccgttttgtatt
tataataaaactgcactatgtactggaagaggagagaaaattgagtttttaaataaacca
ccttcagcttgggtgattcttgctaaaccaaacttaggcatatcatcaccagatatattt
aagttgatcaatttagataagcgttacgacgtacatacgaaaatgtgttatgaggcctta
gaaaatcggaattatcaacaattatgtcaaagtttgtctaatcgattagagccaatttct
gtttcaaaacacccacaaatcgataaattaaaaaacaatatgttgaaaagtggtgcagat
ggtgcgttaatgagtggaagcggaccgactgtgtatgggctagcacgaaaagaaagccaa
gcaaaaaatatttataatgcagttaacggttgttgtaatgaagtgtacttagttagacta
ttaggatag

DBGET integrated database retrieval system