KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_0853Help
Entry
ST398NM01_0853    CDS       T02043                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST398NM01_0853
   01230 Biosynthesis of amino acids
    ST398NM01_0853
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST398NM01_0853
   00051 Fructose and mannose metabolism
    ST398NM01_0853
   00562 Inositol phosphate metabolism
    ST398NM01_0853
Enzymes [BR:sud01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ST398NM01_0853
Exosome [BR:sud04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ST398NM01_0853
  Exosomal proteins of bladder cancer cells
   ST398NM01_0853
  Exosomal proteins of melanoma cells
   ST398NM01_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
783642..784502
Genome map
AA seq 286 aa AA seqDB search
MACLFNIVTGKQSQDDIVFHHFSKIFTKQGVSLMRTPIIAGNWKMNKTVQEAKDFVNALP
TLPDSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALAD
LGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGE
QVKKAVAGLSEEQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEA
TRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtggcatgtttgtttaacattgttacgggaaaacagtcacaagatgacatcgtgtttcat
cacttttcaaaaatatttacaaaacaaggagtgtctttaatgagaacaccaattatagct
ggtaactggaaaatgaacaaaacagtacaagaagcaaaagacttcgtcaatgcattgcca
acattaccagattcaaaagaagtagaatcagtaatttgtgcaccagcaattcaattagat
gcattaactactgcagttaaagaaggaaaagcacaaggtttagaaatcggtgctcaaaat
acgtatttcgaagataatggtgcgttcacaggtgaaacgtctccagttgcattagcagat
ttaggcgttaaatacgttgttatcggccattctgaacgtcgtgaattattccacgaaaca
gatgaagaaattaacaaaaaagcgcatgctattttcaaacatggtatgacaccaattatt
tgtgttggtgaaacagatgaagagcgtgaaagtggtaaagctaacgatgttgtaggtgag
caagttaagaaagctgttgcaggtttatctgaagagcaacttaaatcagttgtaattgct
tatgaaccaatctgggcaatcggaactggtaaatcatcaacatctgaagatgcgaatgaa
atgtgtgcatttgtacgtcaaactattgctgacttatcaagcaaagaagtatcagaagca
actcgtattcaatatggtggtagtgttaaacctaacaacattaaagaatacatggcacaa
actgatattgatggggcattagtaggtggcgcatcacttaaagttgaagatttcgtacaa
ttgttagaaggtgcaaaataa

DBGET integrated database retrieval system