KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1302Help
Entry
ST398NM01_1302    CDS       T02043                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sud00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1233754..1235346
Genome map
AA seq 530 aa AA seqDB search
MFDSWIMLFFRQNLTDFVQWVSDYFLIKEILLMEKYILSIDQGTTSSRAILFNQKGEIAG
VAQREFKQYFPQSGWVEHDANEIWTSVLAVMTEVINENDVRADQIAGIGITNQRETTVVW
DKHTGRPIYHAIVWQSRQTQSICSELKQQGYEQTFRDKTGLLLDPYFAGTKVKWILDNVE
GAREKAENGDLLFGTIDTWLVWKLSGKAAHITDYSNASRTLMFNIHDLEWDDELLELLTV
PKNMLPEVKASSEVYGKTIDYHFYGQEVPIAGVAGDQQAALFGQACFERGDVKNTYGTGG
FMLMNTGDKAVKSESGLLTTIAYGIDGKVNYALEGSIFVSGSAIQWLRDGLRMINSAPQS
ESYATRVDSTEGVYVVPAFVGLGTPYWDSEARGAIFGLTRGTEKEHFIRATLESLCYQTR
DVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQFQADIVNTSVERPEIQETTALGAAYLAGL
AVGFWESKDDIAKNWKLEEKFDPKMDEGEREKLYRGWKKAVEATQVFKTE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattcatggattatgctattttttcgccaaaatttaacagattttgtacaatgg
gttagcgattattttttaataaaggagatactactaatggaaaaatatattttatctata
gaccaaggaacaacaagctcaagagcgattttattcaatcaaaaaggggaaattgcaggg
gtagcacaacgtgagtttaagcaatattttccacaatcaggttgggttgaacatgatgca
aatgaaatttggacatctgtgttagctgtaatgacggaagtaattaatgaaaatgatgtt
agagctgatcaaattgcaggtatcggtattacaaaccaacgtgaaacaacggttgtttgg
gacaaacatactggtcgcccaatttatcacgcaattgtttggcaatcacgtcagacacaa
tcaatttgttcagaattaaaacaacaaggatatgaacaaacatttagagataagacagga
ttacttttagatccgtattttgcaggtacaaaagttaaatggattctagacaatgttgaa
ggtgcacgagaaaaagcagaaaatggcgatctattatttggaacgattgatacttggtta
gtatggaaattatcaggaaaagctgcgcatattactgattattcaaatgcgagtcgtaca
ttaatgtttaatatccatgatttagaatgggacgatgagttattagaactacttacagta
cctaaaaatatgttgccagaagttaaagcttcgagtgaagtatatggtaagacaattgat
taccacttctatggtcaagaagtaccaatcgctggagtagctggtgatcaacaagcagca
ttatttggacaagcttgcttcgaacgtggtgatgtgaaaaacacatatggaactggtggc
ttcatgttaatgaatacaggtgacaaagcggttaaatctgaaagtggtttattaacaaca
attgcttatggtattgatggaaaagtaaattatgcgcttgaaggttcaatctttgtttcg
ggttcagcaatccaatggttacgtgatggattaagaatgattaattcagcaccacaatca
gaaagttatgcgacacgagttgactctactgagggtgtttatgttgttccagcttttgta
ggtttaggaacaccatattgggattctgaagcacgtggtgcgattttcggtttaacacgc
ggaactgaaaaagagcactttatccgtgcaacattagaatcattatgttaccaaactcgt
gacgttatggaagcaatgtcaaaagactctggtatcgatgtccaaagtttacgtgtcgat
ggtggtgcagttaagaataactttattatgcagttccaagcagacattgttaatacttct
gttgaaagacctgaaattcaagaaactacagctttaggtgctgcatatttagcaggttta
gcagttggattctgggagagtaaagatgatatcgctaaaaattggaaattagaagaaaaa
ttcgatccgaaaatggatgaaggcgaaagagaaaaattatatagaggttggaaaaaagct
gttgaagcaacacaagtttttaaaacagaataa

DBGET integrated database retrieval system