KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1331Help
Entry
ST398NM01_1331    CDS       T02043                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00260  Glycine, serine and threonine metabolism
sud00750  Vitamin B6 metabolism
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01230  Biosynthesis of amino acids
Module
sud_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST398NM01_1331
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ST398NM01_1331
Enzymes [BR:sud01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ST398NM01_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AFH69562
UniProt: A0A0E0VNT2
Position
1262843..1263904
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVNENTPKLTLNEGNTPLIHCENMSKILGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEKGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPFRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEAKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWEKATNALKESNGLIDSVTDDEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKDSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagagtttaaagcacatttaccagtaaatgaaaat
acaccaaaattaacattgaacgagggaaatacaccactcattcattgtgaaaatatgtct
aaaatactaggtatagatttatatgtgaagtatgaaggtgccaatccgacaggttcattt
aaagatcgcggtatggtaatggctgtgacaaaagcaaaagagaaaggtaagaaaattgta
atatgcgcttcgactggaaatacatcagcgtctgcagcagcatatgcagctagagcaggt
ttaaaagctatcgtcgtaataccagaaggtaaaattgcgttaggtaaactgtcgcaagca
gtaatgtatggtgcagaaatcgtttctattgaaggaaactttgatgaagctttagaaatt
gtaaaagaaattgcaaaaagtggcgaaatcgagcttgtaaactctgtcaatccatttaga
atcgaagggcaaaagacaggctcatttgaaattgtgcaacaattagacggtgaagcacct
gatattttagcgattcctgtaggtaatgcaggtaatattactgcatattggaaaggcttt
aaagaatatcatgaagctaaaggatcacaattgccgaaaatgtttggcttccaagctgaa
ggcgcatcaccaattgttcaaaataaagtcattaaaaatcctgaaacgattgcaactgct
attcgaattggtaatcctgctagttgggaaaaggcgactaatgctcttaaagaatcaaat
ggattaatagatagtgttactgatgatgaaattctagaagcatatcagttaatgacaact
aaagaaggtgtctttagtgaaccagcaagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaaattacctcaaggtaaaaaagtagttgcgattttaactggtaatgga
ttaaaagatcctgatactgctatttcactactagataatccgataaagccattgccaaat
gataaagatagcattatcgattatattaaaggagctttataa

DBGET integrated database retrieval system