KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1371Help
Entry
ST398NM01_1371    CDS       T02043                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01130  Biosynthesis of antibiotics
sud01230  Biosynthesis of amino acids
Module
sud_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ST398NM01_1371
Enzymes [BR:sud01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ST398NM01_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFH69605
UniProt: A0A0E0VNQ2
Position
1311595..1312386
Genome map
AA seq 263 aa AA seqDB search
MNNMTILEEIVEYKQSLLQNGYYQDKLSTLKSVNIQNKKSFINTIEQEPKLVIIAEIKSK
SPTVNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQELTTKTTLPVLCKDFI
IDPLQIDVAKQAGASMILLIVNILSDKQLRELYEYATSQSLEVLVEVHDREELDRAYKIN
PKLIGVNNRDLKRFVTKVEHTNIILENKQPNHYYISESGIHDTSDVRKILHSGIDGLLIG
EALMRCDNLSEFLPQLKMQKVKS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaataacatgacaattttagaagaaattgttgaatataaacagtcacttttacaaaat
ggctattaccaagacaaacttagcactttaaaaagtgtgaacattcagaataaaaaatct
tttataaacacaattgaacaggaaccaaagttagtaattattgcagaaattaaatcaaag
agtcccacagttaatgacttacctgaacgagatttatctcaacaaatttctgattatgaa
cagtacggtgcaaatgcagtttcaattttaacagatgaaaagtactttggagggagcttt
gaacgtttacaagaattaacaacaaaaacgacacttccagtattgtgtaaagactttatt
atagatccgcttcaaattgacgttgctaaacaagctggtgcatctatgattttacttata
gttaatatcttatctgataaacaattgagagagttatacgaatacgctacttctcaaagt
ttagaagtattggtggaagttcatgatcgtgaagaattagaccgtgcctataagattaat
cctaaattaatcggtgtaaataatcgtgatttaaaacgttttgttacaaaagtggaacat
acaaatattattttagaaaataaacagccgaatcattattatatttcagaaagcggtatt
catgatacctctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggt
gaggcgcttatgcgttgcgacaatctatctgaatttttaccacaactaaaaatgcaaaag
gtgaagtcatga

DBGET integrated database retrieval system