KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1373Help
Entry
ST398NM01_1373    CDS       T02043                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ST398NM01_1373
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST398NM01_1373
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ST398NM01_1373
Enzymes [BR:sud01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ST398NM01_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313011..1314225
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEVDELGFFGEYGGQYVPETLMPAIIELKRAYKKAKEDPEFQRELEYYLSEYVG
RETPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGLPGVLHGTKMYLIQDEGGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMAERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagtagatgaattaggtttctttggcgaatatggaggg
caatacgtacctgaaacgttaatgccagcaattattgaattaaaaagggcttataaaaaa
gcaaaagaagatccagagtttcaaagggaactggaatattatttatcagagtatgtaggg
cgcgagacaccacttacttatgctgcatcatatactgaaagcttaggtggagctaaaata
tatttgaaacgtgaggatttaaatcatacaggcgcacataaaattaataatgcattggga
caagcattacttgcgaaacgtatgggcaagaagaagcttgttgctgaaactggtgcaggt
caacatggtgtagctagtgctactgttgctgcattatttgatatggaacttgttgtcttt
atgggaagcgaagatattaaacgacaacaactcaatgtatttagaatggaattacttggt
gcaaaagttgttgctgttgaagatggtcaagggacattatcagatgcagtgaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccattcccaacgattgttagagattttcaaagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcgttatacggt
gttgaagccgcaggtcaaggcgaggatactgataaacatgcacttgcaattggcaaagga
ttacctggcgtattacatggtactaaaatgtatttaattcaagatgaaggcgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattgggccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgcaagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggcagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system