KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1374Help
Entry
ST398NM01_1374    CDS       T02043                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00260  Glycine, serine and threonine metabolism
sud00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01130  Biosynthesis of antibiotics
sud01230  Biosynthesis of amino acids
Module
sud_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST398NM01_1374
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ST398NM01_1374
Enzymes [BR:sud01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ST398NM01_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA DUF561 His_biosynth IGPS ThiG
Motif
Other DBs
NCBI-ProteinID: AFH69608
UniProt: A0A0E0VQH9
Position
1314161..1314946
Genome map
AA seq 261 aa AA seqDB search
MAIKIWKQLDNIWQSEVLQMTKLFIPYIMGNKDLIENAKILSENGADIIEIGVPFSDPVA
DGPVIMEAGQQAIKQGITIDFIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFERCRD
SGVYGLIIPDLPYELSQRLKQQFSHYDVKIISLVAMTTDDERIKDIVSHAEGFIYTVTMN
ATTGQNGAFHPELKRKIESIKEIANVPVVAGFGIRTPQHVADIKAVADGIVIGSEIVKRF
KANTREEIIEYLQSIKHALNN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcgataaagatatggaaacaattagacaatatatggcagagcgaggtcttgcaaatg
actaaattattcataccttatattatgggcaataaagatttgattgaaaatgcaaaaata
ttaagcgaaaatggtgccgatattattgaaataggtgtgccattctcagatcccgttgct
gatggtccagttatcatggaagcaggacaacaagcgattaaacaaggcatcacgatagat
tttatttttgaacaattagaaaaacatggtaatcaaattaagtgtcagtatgtattaatg
acgtattataatattatttgtcattacggtgaacaagcattttttgaaagatgccgagat
tcaggagtttatggtttaatcattcctgatttaccatacgaattatcacagcgtttaaaa
caacaatttagtcactatgatgtcaaaatcatatcgttagttgctatgactacagatgac
gaacgtataaaagatatcgtatctcatgcggaaggatttatttatactgtgacgatgaat
gcgaccacaggacaaaacggtgcctttcatccagaattaaaacgaaaaatcgaatcaatt
aaagagatagccaatgtgccagttgtcgcaggatttggtataaggaccccacagcatgtt
gcggatataaaagcggtcgcagatggtattgttattggtagtgaaatcgttaagcgattt
aaagctaacacgcgtgaagaaatcattgaatatttacaatctatcaaacacgccttgaac
aattaa

DBGET integrated database retrieval system