KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1374Help
Entry
ST398NM01_1374    CDS       T02043                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ST398NM01_1374
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST398NM01_1374
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ST398NM01_1374
Enzymes [BR:sud01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ST398NM01_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314161..1314946
Genome map
AA seq 261 aa AA seqDB search
MAIKIWKQLDNIWQSEVLQMTKLFIPYIMGNKDLIENAKILSENGADIIEIGVPFSDPVA
DGPVIMEAGQQAIKQGITIDFIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFERCRD
SGVYGLIIPDLPYELSQRLKQQFSHYDVKIISLVAMTTDDERIKDIVSHAEGFIYTVTMN
ATTGQNGAFHPELKRKIESIKEIANVPVVAGFGIRTPQHVADIKAVADGIVIGSEIVKRF
KANTREEIIEYLQSIKHALNN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcgataaagatatggaaacaattagacaatatatggcagagcgaggtcttgcaaatg
actaaattattcataccttatattatgggcaataaagatttgattgaaaatgcaaaaata
ttaagcgaaaatggtgccgatattattgaaataggtgtgccattctcagatcccgttgct
gatggtccagttatcatggaagcaggacaacaagcgattaaacaaggcatcacgatagat
tttatttttgaacaattagaaaaacatggtaatcaaattaagtgtcagtatgtattaatg
acgtattataatattatttgtcattacggtgaacaagcattttttgaaagatgccgagat
tcaggagtttatggtttaatcattcctgatttaccatacgaattatcacagcgtttaaaa
caacaatttagtcactatgatgtcaaaatcatatcgttagttgctatgactacagatgac
gaacgtataaaagatatcgtatctcatgcggaaggatttatttatactgtgacgatgaat
gcgaccacaggacaaaacggtgcctttcatccagaattaaaacgaaaaatcgaatcaatt
aaagagatagccaatgtgccagttgtcgcaggatttggtataaggaccccacagcatgtt
gcggatataaaagcggtcgcagatggtattgttattggtagtgaaatcgttaagcgattt
aaagctaacacgcgtgaagaaatcattgaatatttacaatctatcaaacacgccttgaac
aattaa

DBGET integrated database retrieval system