KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1414Help
Entry
ST398NM01_1414    CDS       T02043                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00020  Citrate cycle (TCA cycle)
sud00310  Lysine degradation
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
sud01200  Carbon metabolism
Module
sud_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sud_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ST398NM01_1414
  Amino acid metabolism
   00310 Lysine degradation
    ST398NM01_1414
Enzymes [BR:sud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ST398NM01_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 IF3_N Herpes_LMP1
Motif
Other DBs
NCBI-ProteinID: AFH69651
UniProt: A0A0E0VQ61
Position
complement(1354958..1356229)
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTN
DDNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKE
EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
MKDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA
AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctgtcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgatgaaacaacaaat
aataaaaaagaagaaacaacaaataaatcggcagataaagctgaagtcaatcaaacaaat
gatgataatcagcagcgtgttaatgctacgccttctgcgcgtcgatatgctcgtgaaaac
ggtgtgaatcttgctgaagtaagtccgaaaacaaatgatgttgttcgtaaagaagatatt
gataaaaaacaacaggcaccggcatcaacacaaacaacacaacaagcacctgcaaaagaa
gagaaaaaatacaatcaatatcctacaaaaccagtgattcgcgaaaaaatgtcacgcaga
aagaaaacagctgctaaaaaattattagaggtatctaataatacagctatgttaacaaca
tttaacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaattt
atgaaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgta
gcagctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacg
aaacaatattatgacattggtgtagctgtttctacagatgatggactattagtaccattc
gtaagagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagct
gttaaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgatt
acaaatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagct
gcaatcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatt
gaaaatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaa
gaagcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttatta
ttagaatcttaa

DBGET integrated database retrieval system