KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1414Help
Entry
ST398NM01_1414    CDS       T02043                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sud01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sud00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sud00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1354958..1356229)
Genome map
AA seq 423 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAVIGEGSGNASKENSNDNTPQQNDETTNNKKEETTNKSADKAEVNQTN
DDNQQRVNATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKE
EKKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQF
MKDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPF
VRDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQA
AILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLL
LES
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctgtcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgatgaaacaacaaat
aataaaaaagaagaaacaacaaataaatcggcagataaagctgaagtcaatcaaacaaat
gatgataatcagcagcgtgttaatgctacgccttctgcgcgtcgatatgctcgtgaaaac
ggtgtgaatcttgctgaagtaagtccgaaaacaaatgatgttgttcgtaaagaagatatt
gataaaaaacaacaggcaccggcatcaacacaaacaacacaacaagcacctgcaaaagaa
gagaaaaaatacaatcaatatcctacaaaaccagtgattcgcgaaaaaatgtcacgcaga
aagaaaacagctgctaaaaaattattagaggtatctaataatacagctatgttaacaaca
tttaacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaattt
atgaaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgta
gcagctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacg
aaacaatattatgacattggtgtagctgtttctacagatgatggactattagtaccattc
gtaagagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagct
gttaaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgatt
acaaatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagct
gcaatcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatt
gaaaatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaa
gaagcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttatta
ttagaatcttaa

DBGET integrated database retrieval system