KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1427Help
Entry
ST398NM01_1427    CDS       T02043                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ST398NM01_1427
   00670 One carbon pool by folate
    ST398NM01_1427
Enzymes [BR:sud01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ST398NM01_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1369054..1369533)
Genome map
AA seq 159 aa AA seqDB search
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEDVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactttatccattctagttgcacatgacttgcaacgagtaattggttttgaaaatcaa
ttaccttggcatctaccaaatgatttgaagcatgttaaaaaattatcaactggtcatact
ttagtaatgggtcgtaagacatttgaatcgattggtaaaccactaccgaatcgtcgaaat
gttgtacttacttcagatacaagtttcaacgtagaggacgttgatgtaattcattctatt
gaagatatttatcaactaccgggccatgtttttatatttggagggcaaacattatttgaa
gaaatgattgataaagtggacgacatgtatattactgttattgaaggtaaatttcgtggt
gatacgttctttccaccttatacatttgaagactgggaagttgcctcttcagttgaaggt
aaactagatgagaaaaatacaattccacatacctttctacatttaattcgtaaaaaataa

DBGET integrated database retrieval system