KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1705Help
Entry
ST398NM01_1705    CDS       T02043                                 

Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sud00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ST398NM01_1705
Enzymes [BR:sud01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ST398NM01_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1612058..1612669)
Genome map
AA seq 203 aa AA seqDB search
MPIMYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQ
LLYGFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGK
KTARQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEK
TLNKNKYDSVDEAVKAGLQLVVS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgcctataatgtacgcgtatgtcaaaggtaagttaacacatttatatcctacacacgta
gttgttgaaactgctggtgttggttatgaaattcaaacaccaaattcttatcgttttcaa
aagcatctagatcatgaagttttaattcatacatctttaattgttcgtgaagatgcacaa
ttattgtatggatttagtagtgaagaagagaaagatatgttcttgagtttaattaaagtt
actggtattggtccgaaatcagctttagctattttagcgacaagtacgcctaatgaagta
aagcgtgccattgaaaatgaaaatgatacgtatttaactaaattcccaggaattggtaag
aaaacggcaagacagattgttttagatttaaaaggtaaagtgaaaatcactgaagaagat
agcgattcattattacaagtagacgctacatcgacggtgcaagatcaattcgtgcaagaa
gcaatgttagcgttagaagcattaggttattctaaacgagagcttgcaaaagttgagaaa
acgttaaataaaaataaatatgactcagttgatgaagctgttaaggcaggtcttcaatta
gttgtatcttaa

DBGET integrated database retrieval system