KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1897Help
Entry
ST398NM01_1897    CDS       T02043                                 

Definition
protoporphyrinogen IX dehydrogenase (EC:1.3.3.4 1.3.5.3)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ST398NM01_1897
Enzymes [BR:sud01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ST398NM01_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802432..1803832)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNKTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGLDLLKKPTQMRDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VKNKGVTIRYNTSVDDIITSQKQYKIVYSNQQEDVFDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDDKLVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacgatcatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaataagactggacaatcttatatttttgcgaaaaacaaattgtatcctattcca
ggtggatcaattatgggaattccgacagatatcaaaccgtttgtgacaactaaattaatt
tcaccacttggaaagttaagagcagggttagatttacttaaaaaacctactcaaatgcgg
gatggtgacatttctgttggtgcatttttcagagcaagattaggtaatgaggtacttgag
aatttaattgagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacctttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccaaaa
ggacaattcaaacaatttaagcatggtttaagttcatttattgaagcattagaacaagat
gtgaaaaataaaggtgtgacaatacgctacaatacgtcagtggatgatattattacatct
caaaagcaatataaaattgtttacagtaatcaacaagaagatgtattcgatggggtatta
gtgacaacaccgcatcaagtctttttgaattggttcgggcaagatccagcatttgattat
tttaaaacgatggatagtacgactgttgcaactgttgtattggcatttgatgaaaaagac
attgaaaatacttatgatggtactggcttcgtgattgcgagaacgagtgatactgacatt
accgcatgtacttggacatcaaaaaaatggccatttactacaccagaaggtaaggttttg
attcgtgcgtatgtaggtaaaccaggtgatactgtggttgatgatcatacagatgataaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggcgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccgcagtaccatgttggtcacattcaa
caaattaggcagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacacaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

DBGET integrated database retrieval system