KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_0399Help
Entry
SAOV_0399         CDS       T01869                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAOV_0399
   01230 Biosynthesis of amino acids
    SAOV_0399
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOV_0399
  Energy metabolism
   00680 Methane metabolism
    SAOV_0399
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAOV_0399
Enzymes [BR:sue01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAOV_0399
Exosome [BR:sue04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAOV_0399
  Exosomal proteins of melanoma cells
   SAOV_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
418646..419227
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTETGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPKFKDFRHS
FSQKAPKGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
agatcttatttttgtggacaattagatgtgccgttaacggaaactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacg
cctttattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaagtatttcaatgatccaaagtttaaagactttcggcatagt
ttttcacaaaaagcgcctaaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttaatggtttattttaataacgtttcacgggaagaagctgtg
gatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system