KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_0399Help
Entry
SAOV_0399         CDS       T01869                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00010  Glycolysis / Gluconeogenesis
sue00260  Glycine, serine and threonine metabolism
sue00680  Methane metabolism
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01120  Microbial metabolism in diverse environments
sue01130  Biosynthesis of antibiotics
sue01200  Carbon metabolism
sue01230  Biosynthesis of amino acids
Module
sue_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sue_M00002  Glycolysis, core module involving three-carbon compounds
sue_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOV_0399
  Energy metabolism
   00680 Methane metabolism
    SAOV_0399
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAOV_0399
Enzymes [BR:sue01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAOV_0399
Membrane trafficking [BR:sue04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAOV_0399
Exosome [BR:sue04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAOV_0399
  Exosomal proteins of melanoma cells
   SAOV_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADI96935
Position
418646..419227
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTETGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPKFKDFRHS
FSQKAPKGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
agatcttatttttgtggacaattagatgtgccgttaacggaaactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgaacatatttttccatatgacattgcatcaacgactacg
cctttattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaagtatttcaatgatccaaagtttaaagactttcggcatagt
ttttcacaaaaagcgcctaaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttaatggtttattttaataacgtttcacgggaagaagctgtg
gatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system