KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_0821Help
Entry
SAOV_0821         CDS       T01869                                 

Definition
carboxylesterase precursor
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
852447..853187
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMHHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYEHVDSDEKDIKWYSQSGHVITIDKEKEQVFDDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccgcaatatgaaggccatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagaatatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgattgataacgaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagatcaagttgatgaggtgtttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaacatgtagactctgacgaaaaagatatcaaatggtatagtcagtcaggacat
gttattacaattgataaagaaaaagaacaagttttcgatgatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system