KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_1383Help
Entry
SAOV_1383         CDS       T01869                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sue01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sue00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sue00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1424056..1424784
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLFSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPFELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKEIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgtttagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcataacgata
gattatattttcgagcaattagaaaaacacggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gataccggtgtttacggcttaattattcctgatttaccatttgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaattatatcgttagttgcgatgactactgat
gacaaacgtataaaagaaatcgtatcccatgcggaagggtttatttatactgtgacgatg
aatgcgacaacaggacaaaacggtgcgtttcacccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaactccacaacat
gttgcagatataaaagaggttgcagatggtatcgttattggtagtgaaatagtaaaacga
tttaaatctaacacgcgtgaagaaatcattaaatatttacaatctatccagcaaacattg
aataattaa

DBGET integrated database retrieval system