KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_1547Help
Entry
SAOV_1547         CDS       T01869                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00010  Glycolysis / Gluconeogenesis
sue00052  Galactose metabolism
sue00500  Starch and sucrose metabolism
sue00520  Amino sugar and nucleotide sugar metabolism
sue00521  Streptomycin biosynthesis
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01120  Microbial metabolism in diverse environments
sue01130  Biosynthesis of antibiotics
sue01200  Carbon metabolism
Module
sue_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sue_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOV_1547
   00052 Galactose metabolism
    SAOV_1547
   00500 Starch and sucrose metabolism
    SAOV_1547
   00520 Amino sugar and nucleotide sugar metabolism
    SAOV_1547
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAOV_1547
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAOV_1547
Enzymes [BR:sue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAOV_1547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADI98051
Position
complement(1617613..1618599)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLSIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFTPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaagtattttc
acacctgaattagaacaattacataagtggtctattcacactgatacatctgatagtaca
ggatatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtcaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtactggtctaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttagttaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttacacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system