KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_1657Help
Entry
SAOV_1657         CDS       T01869                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00860  Porphyrin and chlorophyll metabolism
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAOV_1657 (hemB)
Enzymes [BR:sue01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SAOV_1657 (hemB)
Exosome [BR:sue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAOV_1657 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD HMA
Motif
Other DBs
NCBI-ProteinID: ADI98161
Position
complement(1729326..1730300)
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRSSATMRDMVRENHVRKEDLIYPIFVVEKDDVKKEIKSLPGVYQISLNLLE
SELKEAYDLGIRAIMFFGVPNSKDNIGTGAYIHDGVIQQATRIAKKMYDDLLIVADTCLC
EYTDHGHCGVIDDHTHDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRRGLD
EAGYYNIPIMSYGVKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GCDMMIVKPALSYLDIVRDVKNHTNVPVVAYNVSGEYSMTKAAAQNGWIDEERVVMEQMV
SMKRAGADMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacatagaagattgagatcatcagcgacaatgagagatatggttaga
gagaatcatgtaagaaaagaagatttaatatatccaatttttgtagttgaaaaagacgat
gtgaaaaaagaaattaagtcattgccaggtgtataccaaatcagtttgaatttacttgaa
agtgagttaaaagaagcttatgacttaggcatacgtgccattatgtttttcggtgttcca
aactcaaaagataatataggtactggtgcatacattcacgatggtgttattcaacaggca
acacgtattgctaaaaaaatgtatgatgacttattaattgttgcagacacttgtttgtgt
gaatatactgatcatggtcattgtggtgtgattgatgaccatacacatgacgttgacaat
gataaatcattgccactacttgttaaaacagcaatttctcaagtggaagctggagctgat
attattgcaccaagtaatatgatggatggttttgttgctgaaattcgtcgtggacttgat
gaagccggctattacaatattcctataatgagttatggtgtcaagtatgcatctagtttc
tttggaccttttagagatgcagcagattcagcgccatcatttggtgatagaaaaacgtat
cagatggaccctgctaaccgtttggaagcacttcgtgaattagaaagtgatcttaaagaa
gggtgcgacatgatgattgttaaacctgctctaagttatttagacatagttcgagacgtt
aaaaatcatacgaatgttccagttgttgcatataatgtgagtggagaatatagtatgact
aaagcagcggcacaaaatggttggatagatgaagaacgtgtcgttatggaacaaatggtt
tcaatgaaacgtgcaggtgctgatatgattattacgtattttgcaaaggacatttgtcgc
tatttagataaataa

DBGET integrated database retrieval system