KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_1719Help
Entry
SAOV_1719         CDS       T01869                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00010  Glycolysis / Gluconeogenesis
sue00620  Pyruvate metabolism
sue00640  Propanoate metabolism
sue00680  Methane metabolism
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01120  Microbial metabolism in diverse environments
sue01130  Biosynthesis of antibiotics
sue01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAOV_1719
   00620 Pyruvate metabolism
    SAOV_1719
   00640 Propanoate metabolism
    SAOV_1719
  Energy metabolism
   00680 Methane metabolism
    SAOV_1719
Enzymes [BR:sue01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAOV_1719
Lipid biosynthesis proteins [BR:sue01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAOV_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADI98223
Position
complement(1807978..1809684)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGSGDK
IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDENVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgaagtatataaaggagcgcaaggcaaacataatcttaaagattatgaagaa
acatataatacttttgattggaaagacgtagaacaagcattttcttggagtgaaactgga
aaaatgaacatggcatatgaatgtatagatcgccatgtagatcaaggatcaggggataaa
atagcgttaaattacaaagatgagcacagaaaagaatcgtatacttataaagatatgcaa
cggttatctaataaagcagcgaatgttttgtctgaacatgcagaagttgacaaaggtgac
agagtatttatatttatgtcgcgtacacctgaactatattttgcgttgttaggtgtttta
aaaattggtgcaattgttgggccgttatttgaagcatttatggaaaaggcagttgcggat
agattagagaacagtgaagctaaagtgttaattactaataaggcattgttacctcgagta
cctgtagataaattaccgaacttgaaaaaaattgttgttgtagatgagaatgtagaagac
aattacatagactttattagtttgatggaaactgctagcgatgaatttgacattgaatgg
ttaaagtcggatgatggtttgattttacattatacatcaggttctactgggcaacctaaa
ggtgtattgcatgttcaacaagcaatgttagtgcattatatttctggaaaatatgtatta
gatttacaagaagatgatgtttattggtgtacagcagatccaggttgggttacaggaaca
tcttatggtatttttgcaccatggttaaatggcgctacaaattgtatagctggtggtcgc
ttttcaccagaacagtggtatagtatgattgaagattttaaagtgacgatttggtatacg
gcaccaacagctttaagaatgttaatgagtgctggtgacgatattgttgagaaatatgac
ttgtcatcgttacgttcgattctatcagtaggtgagcctttaaatcctgaagttataaaa
tgggcgaaaaaagtatacggtttaacggtgttagatacttggtggatgacagaaacaggt
ggacatatgattgttaactatccaacgatggacgtcaagcttggctcaatgggcaaacca
ttacctggtattcaagctgcaattatcgatgatgcaggtaatgaattaccaccaaatcga
atgggcaaccttgctataaaaaaaggctggccatcaatgatgtatcgtatctggaagaat
ccagaaaaatataagtcatattttattggagactggtatgtatctggtgattcggcatat
aaagatgaagatggttacttctggttccaaggacgtgttgatgatgtaattatgacagct
ggtgaacgagttggaccatttgaggttgagtctaaattggttgaacacgaagcagttgcc
gaagcaggaattattggtaaacctgatccggttcgcggtgaaataattaaggcgtttgtt
gcactgagaaaaggatatgaaccaacagacgaattaaaagaagaaattcgtttatttgtt
aaagaaggtttgtcggcacatgcagcaccacgtgaaatcgaatttaaagataaattacct
aaaacacgctcaggtaaaattatgagacgtgtattaaaagcttgggaattaaatttagat
gcaggggatttaagtacaatggaataa

DBGET integrated database retrieval system