KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_1827Help
Entry
SAOV_1827         CDS       T01869                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAOV_1827 (hemY)
Enzymes [BR:sue01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SAOV_1827 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1916131..1917378)
Genome map
AA seq 415 aa AA seqDB search
MIELGPESYLGRKTIMTELAKDIGLEQDIVTNKTGQSYIFAKNKLYPIPGGSIMGIPTDI
KPFVTTKLISPLGKLRAGLDLLKKPTQMRDGDISVGAFFRARLGNEVLENLIEPLMGGIY
GTDIDKLSLMSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLS
SFIEALEQDVKNKGVTIRYNTSVDDIITSQKQYKIVYSNQQEDVFDGVLVTTPHQVFLNW
FGQDPAFDYFKTMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSDTDITACTWTSKKWP
FTAPEGKVLIRAYVGKPGDTVVDDHTDDELVSLVRRDLSQMMTFKGDPEFTIVNRLPKSM
PQYHVGHIQQIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattgaactagggcctgaatcttatttaggtagaaaaacgatcatgacagaattagcg
aaagatattggattagaacaagatattgttacaaataagactggacaatcttatattttt
gcgaaaaacaaattgtatcctattccaggtggatcaattatgggaattccgacagatatc
aaaccgtttgtgacaactaaattaatttcaccacttggaaagttaagagcagggttagat
ttacttaaaaaacctactcaaatgcgggatggtgacatttctgttggtgcatttttcaga
gcaagattaggtaatgaggtacttgagaatttaattgagcctttaatgggtggtatttat
ggtaccgatattgataaattaagtttgatgagtacgtttcctaattttaaagaaaaagaa
gaggcattcggaagtctgataaagggtatgaaggatgaaaaaaataagcgtctgaaacaa
agacaattatatcctggcgcaccaaaaggacaattcaaacaatttaagcatggtttaagt
tcatttattgaagcattagaacaagatgtgaaaaataaaggtgtgacaatacgctacaat
acgtcagtggatgatattattacatctcaaaagcaatataaaattgtttacagtaatcaa
caagaagatgtattcgatggggtattagtgacaacaccacatcaagtctttttgaattgg
ttcgggcaagatccagcatttgattactttaaaacgatggatagtacgactgttgcaact
gttgtattggcatttgatgaaaaagacattgaaaatacttatgatggtactggctttgtg
attgcgagaacgagtgatacagacattaccgcatgtacttggacatcgaaaaaatggcca
tttactgcaccagaaggtaaggttttgattcgtgcttatgtaggtaaaccaggtgatact
gtggttgatgatcatacagatgatgaattagtatcgcttgtacgtagagatttaagtcaa
atgatgacatttaaaggcgatcctgaatttacaattgtcaatcgtttgccgaaaagtatg
ccacagtaccatgttggtcacattcaacaaattagacagattcaagcacatattaaacaa
acatatccacgacttagagtaactggtgcatcttttgaagcggttggactacctgattgt
attacgcaaggtaaagttgctgctgaagaagtaatcgcagagttgtaa

DBGET integrated database retrieval system