KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_2541cHelp
Entry
SAOV_2541c        CDS       T01869                                 

Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAOV_2541c
   00052 Galactose metabolism
    SAOV_2541c
   00500 Starch and sucrose metabolism
    SAOV_2541c
   00520 Amino sugar and nucleotide sugar metabolism
    SAOV_2541c
Enzymes [BR:sue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAOV_2541c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2589701..2590495)
Genome map
AA seq 264 aa AA seqDB search
MPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRHKRAIEDHFDSQKELEMVLKEKGKS
ELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQFIGNEPFAVLLGDDIVESEVPAVKQ
LIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNGRQYEVKKFVEKPAQGTAPSNLAIM
GRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNNDNQVYAYDFEGERYDVGEKLGFVKT
TIEYALKDDSMREELTRFIKELGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggaaatgcttcctatcttagataaacccacaatacaatatatcgttgaagaa
gctgcaagagctggaattgaagatattattatagtgacaggtcgccataaacgcgcgatt
gaagatcattttgatagtcaaaaagaattagaaatggtgttaaaagaaaaaggtaaatct
gaattactagaaaaagttcagtattcaacggaacttgcgaatattttttatgtaaggcag
aaagaacaaaaaggtttagggcatgcgattagttctgcgcgtcaatttatcggcaatgaa
ccatttgcggtattattaggtgacgatattgttgaatctgaagtgccagcagtgaaacag
ttgattgacgtttatgaagaaacggggcactcagttataggtgtccaagaagttccggaa
gcagatactcatcgttatggaattattgatccattaactaaaaatggacgtcagtatgaa
gtgaaaaagtttgttgaaaagccagcacaaggtacggcaccatcaaacctagctattatg
gggcgatatgtattaacgcctgaaattttcgattatttaaaaacgcaaaaagaaggcgca
ggtaacgaaattcagttaacagatgcgattgagcgtatgaataacgataaccaagtgtat
gcatatgacttcgaaggcgaacgttacgatgttggagaaaaattaggatttgtcaaaaca
acgatagaatatgcgttgaaagatgacagtatgcgagaagaattaacacgatttattaaa
gaattaggtttataa

DBGET integrated database retrieval system