KEGG   Staphylococcus aureus subsp. aureus LGA251: SARLGA251_01220Help
Entry
SARLGA251_01220   CDS       T02085                                 

Gene name
adhE
Definition
putative aldehyde-alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:suf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SARLGA251_01220 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARLGA251_01220 (adhE)
   00620 Pyruvate metabolism
    SARLGA251_01220 (adhE)
   00650 Butanoate metabolism
    SARLGA251_01220 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SARLGA251_01220 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SARLGA251_01220 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SARLGA251_01220 (adhE)
   00626 Naphthalene degradation
    SARLGA251_01220 (adhE)
Enzymes [BR:suf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SARLGA251_01220 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SARLGA251_01220 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
143816..146425
Genome map
AA seq 869 aa AA seqDB search
MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDHIVHQMSLAAVDQHMV
LAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGEDKEKGLTYVAEPIGVIC
GVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAEVVLEAAMKAGAPKDIIQ
WIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPALGVGPGNVPSYIEKTAHIK
RAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAHQAYFVKKDELQRLENAIMN
EQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGVGSDYPLSREKLSPVLALVKA
QSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLRMKACRVLVNTPSAVGGIGDMY
NELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRRNNTQIFKVPAQIYFEENAIMSL
TTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQKTEQPQIKIFSEVEPNPSTNTVYKGLEM
MVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFFGAKQKFLDIGKRTYKIGMPENATF
ICIPTTSGTGSEVTPFAVITDSETNVKYPLADFALTPDVAIIDPQFVMSVPKSVTADTGM
DVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYLKSSVEKGDKVSREKMHNASTLAGMAF
ANAFLGIAHSIAHKIGGEYGIPHGRANAILLPHIIRYNAKDPQKHALFPKYEFFRADTDY
ADIAKFLGLKGNTTEALVESLAKAVYELGQSVGIEMNLKSQGVSEEELNESIDRMAELAF
EDQCTTANPKEALISEIKDIIQTSYDYKQ
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgttaactatacctgaaaaagaaaatcgtggatcgaaagaacaagaagtggcaattatg
attgatgctctagctgacaaagggaaaaaagcattagaagcattatctaaaaagtcacaa
gaagaaattgatcatattgttcatcaaatgagtttagcagctgttgatcaacatatggtg
ctagcaaaattagcacatgaagaaactggaagaggtatatacgaagataaagcgattaaa
aatttatacgcttctgaatatatatggaattcaataaaagacaataagacagtagggatt
attggtgaagataaagaaaaaggattaacgtatgtagcggaaccaattggtgttatttgt
ggtgttacgccaacaacaaatcctacgtcgacaactatttttaaagcgatgattgcaatt
aagacaggaaatccaatcatttttgcattccatccaagtgcgcaagaatcgtcgaagcgt
gcagcagaagttgtattagaagcggcaatgaaggcaggtgcacctaaagatattattcaa
tggattgaagtgccttctatcgaagcaacaaaacaattaatgaatcacaaaggtattgca
ttagttctagcaacaggtggttcgggcatggttaagtctgcatattcaactggcaaaccg
gcattaggtgtgggaccaggtaacgtgccgtcttacattgaaaaaacagcacacattaag
cgtgcagtaaatgatatcattggttcaaaaacatttgataatggtatgatttgtgcttct
gaacaagttgtagtcattgataaagaaatttataaagacgttactaatgaatttaaagca
catcaagcatattttgttaaaaaagatgaattacaacgcttagaaaatgcaattatgaat
gaacaaaaaacaggtattaagcctgatattgtcggtaaatctgcagttgaaatagctgaa
ttagcaggtatacctgtccccgaaaatacaaaacttatcatagccgaaattagcggtgta
ggttcagactatccgttatctcgtgaaaaattatctccagtattagccttagtaaaagcc
caatctacaaaacaagcatttcaaatttgtgaagacacactacattttggtggattagga
cacacagccgttatccatacagaagatgaaacattacaaaaagattttggtctaagaatg
aaagcttgtcgtgtacttgtaaatacaccatcagcggttggaggtattggtgatatgtat
aacgaattgattccgtctttaacattaggttgtggttcgtacggtagaaactcaatttca
cataatgttagtgcgacagatttattaaacattaaaacgattgctaaacgacgtaataat
actcaaattttcaaggtgcctgctcaaatttattttgaagaaaatgcaatcatgagtcta
acaacaatggacaagattgaaaaagtgatgattgtctgtgaccctggtatggtcgaattc
ggttatacaaaaacagttgagaatgtattaagacaaaaaacggaacagcctcaaattaaa
atatttagcgaagtcgaaccgaacccatcaacgaatacagtatataaaggtctggaaatg
atggttgatttccaaccggatacaatcattgcacttggtggtggttcagcgatggatgct
gcaaaagcaatgtggatgttctttgaacaccctgagacatcattcttcggtgctaaacaa
aagttcctagacatcggtaaacgtacttataaaataggcatgcctgaaaatgcgacgttc
atttgtatccctacgacatcaggtacaggttcagaagtaacaccatttgcagttatcaca
gatagtgaaacaaatgtaaaatatccgttggctgattttgctttaacacctgatgttgca
attattgaccctcaatttgtgatgagtgtgccaaaaagcgttacagcagatacaggaatg
gatgtactaacgcatgccatggaatcatatgtatctgtaatggcttcagattacacaaga
ggtttgagtctacaagcgattaaattgacgttcgaatatttaaaatcatctgttgaaaaa
ggtgataaagtttcaagagagaaaatgcataacgcatcaactttggctggtatggcattt
gcaaatgcattcttaggcattgcacactcaattgcgcataaaattggtggcgaatatggt
attccgcatggtagagcgaatgcgatattactaccgcatattatccgttataatgccaaa
gacccgcaaaaacatgcattattccctaaatatgagttcttcagagcagatacagattat
gcagatattgccaaattcttaggattaaaaggtaatacgacagaagcactcgtagaatca
ttagctaaagctgtctacgaattaggtcaatcagtcggaattgaaatgaatttgaaatca
caaggtgtgtctgaagaagaattaaatgagtcaattgatagaatggcagagctcgcattt
gaagatcaatgtacaactgctaatcctaaagaagcactaatcagtgaaatcaaagatatc
attcaaacatcatatgattataagcaataa

DBGET integrated database retrieval system