KEGG   Staphylococcus aureus subsp. aureus LGA251: SARLGA251_03910Help
Entry
SARLGA251_03910   CDS       T02085                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251
Brite
Enzymes [BR:suf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SARLGA251_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450280..451014
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFSCYAPNYPGHGLLLKD
FMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLAQNYPLKRIAVMSAPKE
KSDDGLIEHLVYYSQRMSNILNLDQQASSAQLAAIDDYEGEITKFQHFIDDIMTNLNVIK
IPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHLMTHGEGRDILEENVIRFF
NALT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtccatcttatttaaaaggcacaaatggacatgcgatatta
ttattacattcatttacaggtacaaatcgggatgtgaagcatcttgcagctgagttaaat
gaccaaggatttagttgttatgcaccgaattatccaggtcatggtttattgttgaaagat
ttcatgacatataatgtagatgattggtgggaagaagttgagaaagcttaccaattttta
gtcaatgaaggttatgaatctatcagtgcaactggtgtgtctttaggtggattaatgaca
ttgaaattggcgcaaaactacccgttgaaacgtatcgctgtcatgtcagcaccaaaggaa
aagagtgacgatggcttaatagaacatttagtttattatagtcaacgcatgtcgaatatt
ttaaatttagatcagcaagcatcgagtgcgcaattagcagcaattgatgattatgaaggt
gaaattacgaagtttcaacattttattgatgatatcatgacaaatttaaatgttattaaa
attccagctaatatattatttggtggtaaagatgcaccatcctatgaaacaagtgcacac
tttatttatgaacatttaggatcagtagacaaagaattaaatggtctgaaggattcacat
catttaatgacgcatggagaaggcagagatattttagaagaaaatgttattcgctttttc
aatgctttaacgtaa

DBGET integrated database retrieval system