KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0631Help
Entry
SAPIG0631         CDS       T02071                                 

Definition
deoxynucleoside kinase family protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAPIG0631
   00240 Pyrimidine metabolism
    SAPIG0631
Enzymes [BR:sug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SAPIG0631
    2.7.1.76  2'-deoxyadenosine kinase
     SAPIG0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(664146..664808)
Genome map
AA seq 220 aa AA seqDB search
MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHNPYLDKFYSDFERWSF
HLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEEGTMSKEDFKTYSDLFN
AMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEYWKKLFKRYDDWINSFNA
CPVVRININEYDIHKDPDSLNPMIDKIARIIQTYRQVDTR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaataattacggtattccacaaaatgccattataaccattgcaggtacagttggtgtt
ggaaaatcaacactaacgcaagcacttgcagataaattaaactttaaaacgtcttttgaa
aatgtcgaacataatccatatttagataaattttacagcgattttgaacgatggagtttc
catttacaaatttatttcttagctgaacgctttaaagaacaaaagcgtatgtttgaatat
ggtggtggctttgtccaagatcgatcaatttatgaagatgttgatatttttgcaaaaatg
catgaagaagaaggcacaatgagtaaagaggatttcaaaacatattcagacttatttaat
gccatggtcatgacaccttattttcctaaacctgatgtaatgatttatttagaatgtaat
tatgatgaggtcattgatcgtattattgaacgtggtcgcgaaatggaaataaatactgat
cctgaatattggaaaaagttatttaaacgttatgacgattggattaacagctttaatgca
tgtcctgtggtacgtatcaacattaatgaatatgatatacacaaagatcctgattcttta
aatcctatgattgataaaatcgctcgaattattcaaacatatcgacaagtagatacacga
taa

DBGET integrated database retrieval system