KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0853Help
Entry
SAPIG0853         CDS       T02071                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAPIG0853 (tpiA)
   01230 Biosynthesis of amino acids
    SAPIG0853 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAPIG0853 (tpiA)
   00051 Fructose and mannose metabolism
    SAPIG0853 (tpiA)
   00562 Inositol phosphate metabolism
    SAPIG0853 (tpiA)
Enzymes [BR:sug01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAPIG0853 (tpiA)
Exosome [BR:sug04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAPIG0853 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAPIG0853 (tpiA)
  Exosomal proteins of melanoma cells
   SAPIG0853 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899637..900398
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEEQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggccattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcatgctattttcaaa
catggtatgacaccaattatttgtgttggtgaaacagatgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagagcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system