KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0853Help
Entry
SAPIG0853         CDS       T02071                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00010  Glycolysis / Gluconeogenesis
sug00051  Fructose and mannose metabolism
sug00562  Inositol phosphate metabolism
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01120  Microbial metabolism in diverse environments
sug01130  Biosynthesis of antibiotics
sug01200  Carbon metabolism
sug01230  Biosynthesis of amino acids
Module
sug_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sug_M00002  Glycolysis, core module involving three-carbon compounds
sug_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAPIG0853 (tpiA)
   00051 Fructose and mannose metabolism
    SAPIG0853 (tpiA)
   00562 Inositol phosphate metabolism
    SAPIG0853 (tpiA)
Enzymes [BR:sug01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAPIG0853 (tpiA)
Exosome [BR:sug04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAPIG0853 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAPIG0853 (tpiA)
  Exosomal proteins of melanoma cells
   SAPIG0853 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAQ49280
Structure
PDB: 

Jmol
Position
899637..900398
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEEQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggccattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcatgctattttcaaa
catggtatgacaccaattatttgtgttggtgaaacagatgaagagcgtgaaagtggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagagcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaactattgctgacttatca
agcaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system