KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1207Help
Entry
SAPIG1207         CDS       T02071                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SAPIG1207 (gmk)
Enzymes [BR:sug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SAPIG1207 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1260699..1261322
Genome map
AA seq 207 aa AA seqDB search
MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
FIFLAPPSLDHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
QCIVEAEHLKRERVEAKYRKMILEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaaaaaggattgttaatcgttttatcaggaccatctggagtaggtaaaggt
actgttagaaaacgaatatttgaagatccaagtacatcatataagtattctatttcaatg
acaacacgtcaaatgcgtgaaggtgaagttgatggcgtagattacttttttaaaactagg
gatgcgtttgaagctttaattaaagatgaccaatttatagaatatgctgaatatgtaggc
aactattatggtacaccagttcaatatgttaaagatacaatggacgaaggtcatgatgta
tttttagaaattgaagtagaaggtgcaaagcaagttagaaagaaatttccagatgcgtta
tttattttcttagcacctccaagtttagatcacttgagagagcgattagtaggtagagga
acagaatctgatgagaaaatacaaagtcgtattaacgaagcacgtaaagaagtcgaaatg
atgaatttatacgattacgttgtagttaatgatgaagtagaacttgcgaagaatagaatt
caatgtattgtagaagctgagcacttaaaaagagagcgcgtagaagctaagtatagaaaa
atgattttggaggctaaaaaataa

DBGET integrated database retrieval system