KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1245Help
Entry
SAPIG1245         CDS       T02071                                 

Definition
succinyl-CoA synthetase beta chain (SCS-alpha)(Vegetative protein 63) (VEG63) (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAPIG1245
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAPIG1245
   00640 Propanoate metabolism
    SAPIG1245
   00660 C5-Branched dibasic acid metabolism
    SAPIG1245
Enzymes [BR:sug01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAPIG1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1300848..1302014
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
LKDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttcaatgggcgttgcagttcca
gaaggacgagtagcatttactgctgaagaagcggtggagaaagcaaaagaattaaattct
gatgtttatgttgtaaaagcacaaattcatgctggaggtagaggtaaagcaggcggagta
aaaattgctaaatctttatcagaggtagaaacatatgcaaaagaattattagggaaaact
ttggtgacacatcaaactggtccagaaggtaaagaaattaagcgtttatatatcgaagaa
ggttgtgctattcaaaaagaatattacgttggattcgttattgatcgtgcgactgaccaa
gtaacattgatggcgtctgaagaagggggcactgagattgaagaagttgctgcgaagact
cctgaaaagatcttcaaagaaactatcgatccagtaatcggactttcaccattccaagca
agacgaattgcgtttaatattaatattcctaaagaatctgttaacaaagctgctaaattc
ttattagcactttataatgtattcattgaaaaagattgttcaatcgtagaaatcaaccca
ttagttacaacagctgatggtgatgtattggcattagatgctaaaattaattttgatgat
aatgcattattcagacataaagatgttgtagaattacgtgatttagaagaagaagatccg
aaagagattgaagcgtctaaacatgatttatcatacattgcattagatggtgacatcgga
tgtatggttaatggtgcaggtttagccatggcaacaatggatacgattaatcatttcggt
ggaaacccagccaatttcttagatgcaggcggaagcgctactagagaaaaagtaactgaa
gcatttaaaatcattttaggtgatgaaaatgttaaaggtatttttgtaaacattttcggt
ggcattatgaaatgtgatgttatcgcagaaggtatcgttgaagctgtaaaagaagtagat
ttaactttaccactagttgtacgcttagaaggtacaaatgttgagttaggtaaaaaaatc
ttaaaagactcaggattagcaattgaaccagcagcaacaatggctgaaggtgcacaaaaa
attgttaaactagtcaaagaagcataa

DBGET integrated database retrieval system