KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1331Help
Entry
SAPIG1331         CDS       T02071                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAPIG1331 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAPIG1331 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAPIG1331 (thrC)
Enzymes [BR:sug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAPIG1331 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395305..1396366
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVNENTPKLTLNEGNTPLIHCENMSKILGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEKGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPFRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHEAKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWEKATNALKESNGLIDSVTDDEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKDSIIDYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagagtttaaagcacatttaccagtaaatgaaaat
acaccaaaattaacattgaacgagggaaatacaccactcattcattgtgaaaatatgtct
aaaatactaggtatagatttatatgtgaagtatgaaggtgccaatccgacaggttcattt
aaagatcgcggtatggtaatggctgtgacaaaagcaaaagagaaaggtaagaaaattgta
atatgcgcttcgactggaaatacatcagcgtctgcagcagcatatgcagctagagcaggt
ttaaaagctatcgtcgtaataccagaaggtaaaattgcgttaggtaaactgtcgcaagca
gtaatgtatggtgcagaaatcgtttctattgaaggaaactttgatgaagctttagaaatt
gtaaaagaaattgcaaaaagtggcgaaatcgagcttgtaaactctgtcaatccatttaga
atcgaagggcaaaagacaggctcatttgaaattgtgcaacaattagacggtgaagcacct
gatattttagcgattcctgtaggtaatgcaggtaatattactgcatattggaaaggcttt
aaagaatatcatgaagctaaaggatcacaattgccgaaaatgtttggcttccaagctgaa
ggcgcatcaccaattgttcaaaataaagtcattaaaaatcctgaaacgattgcaactgct
attcgaattggtaatcctgctagttgggaaaaggcgactaatgctcttaaagaatcaaat
ggattaatagatagtgttactgatgatgaaattctagaagcatatcagttaatgacaact
aaagaaggtgtctttagtgaaccagcaagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaaattacctcaaggtaaaaaagtagttgcgattttaactggtaatgga
ttaaaagatcctgatactgctatttcactactagataatccgataaagccattgccaaat
gataaagatagcattatcgattatattaaaggagctttataa

DBGET integrated database retrieval system