KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1371Help
Entry
SAPIG1371         CDS       T02071                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAPIG1371 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAPIG1371 (trpC)
Enzymes [BR:sug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAPIG1371 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1444067..1444849
Genome map
AA seq 260 aa AA seqDB search
MTILEEIVEYKQSLLQNGYYQDKLSTLKSVNIQNKKSFINTIEQEPKLVIIAEIKSKSPT
VNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQELTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLRELYEYATSQSLEVLVEVHDREELDRAYKINPKL
IGVNNRDLKRFVTKVEHTNIILENKQPNHYYISESGIHDTSDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttagaagaaattgttgaatataaacagtcacttttacaaaatggctattac
caagacaaacttagcactttaaaaagtgtgaacattcagaataaaaaatcttttataaac
acaattgaacaggaaccaaagttagtaattattgcagaaattaaatcaaagagtcccaca
gttaatgacttacctgaacgagatttatctcaacaaatttctgattatgaacagtacggt
gcaaatgcagtttcaattttaacagatgaaaagtactttggagggagctttgaacgttta
caagaattaacaacaaaaacgacacttccagtattgtgtaaagactttattatagatccg
cttcaaattgacgttgctaaacaagctggtgcatctatgattttacttatagttaatatc
ttatctgataaacaattgagagagttatacgaatacgctacttctcaaagtttagaagta
ttggtggaagttcatgatcgtgaagaattagaccgtgcctataagattaatcctaaatta
atcggtgtaaataatcgtgatttaaaacgttttgttacaaaagtggaacatacaaatatt
attttagaaaataaacagccgaatcattattatatttcagaaagcggtattcatgatacc
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgcgacaatctatctgaatttttaccacaactaaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system