KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1373Help
Entry
SAPIG1373         CDS       T02071                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAPIG1373 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAPIG1373 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAPIG1373 (trpB)
Enzymes [BR:sug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAPIG1373 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1445474..1446688
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEVDELGFFGEYGGQYVPETLMPAIIELKRAYKKAKEDPEFQRELEYYLSEYVG
RETPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGLPGVLHGTKMYLIQDEGGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMAERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagtagatgaattaggtttctttggcgaatatggaggg
caatacgtacctgaaacgttaatgccagcaattattgaattaaaaagggcttataaaaaa
gcaaaagaagatccagagtttcaaagggaactggaatattatttatcagagtatgtaggg
cgcgagacaccacttacttatgctgcatcatatactgaaagcttaggtggagctaaaata
tatttgaaacgtgaggatttaaatcatacaggcgcacataaaattaataatgcattggga
caagcattacttgcgaaacgtatgggcaagaagaagcttgttgctgaaactggtgcaggt
caacatggtgtagctagtgctactgttgctgcattatttgatatggaacttgttgtcttt
atgggaagcgaagatattaaacgacaacaactcaatgtatttagaatggaattacttggt
gcaaaagttgttgctgttgaagatggtcaagggacattatcagatgcagtgaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccattcccaacgattgttagagattttcaaagtgtgattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcgttatacggt
gttgaagccgcaggtcaaggcgaggatactgataaacatgcacttgcaattggcaaagga
ttacctggcgtattacatggtactaaaatgtatttaattcaagatgaaggcgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattgggccagaacattct
tattaccacgacattggtagagtaacttttgaaaatgcaagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggcagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system