KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1374Help
Entry
SAPIG1374         CDS       T02071                                 

Gene name
trpA
Definition
tryptophan synthase, alpha subunit (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAPIG1374 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAPIG1374 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAPIG1374 (trpA)
Enzymes [BR:sug01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAPIG1374 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1446681..1447409
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENAKILSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DFIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFERCRDSGVYGLIIPDLPYELSQRL
KQQFSHYDVKIISLVAMTTDDERIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKEIANVPVVAGFGIRTPQHVADIKAVADGIVIGSEIVKRFKANTREEIIEYLQSIKHAL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattattcataccttatattatgggcaataaagatttgattgaaaatgcaaaa
atattaagcgaaaatggtgccgatattattgaaataggtgtgccattctcagatcccgtt
gctgatggtccagttatcatggaagcaggacaacaagcgattaaacaaggcatcacgata
gattttatttttgaacaattagaaaaacatggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatattatttgtcattacggtgaacaagcattttttgaaagatgccga
gattcaggagtttatggtttaatcattcctgatttaccatacgaattatcacagcgttta
aaacaacaatttagtcactatgatgtcaaaatcatatcgttagttgctatgactacagat
gacgaacgtataaaagatatcgtatctcatgcggaaggatttatttatactgtgacgatg
aatgcgaccacaggacaaaacggtgcctttcatccagaattaaaacgaaaaatcgaatca
attaaagagatagccaatgtgccagttgtcgcaggatttggtataaggaccccacagcat
gttgcggatataaaagcggtcgcagatggtattgttattggtagtgaaatcgttaagcga
tttaaagctaacacgcgtgaagaaatcattgaatatttacaatctatcaaacacgccttg
aacaattaa

DBGET integrated database retrieval system