KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1683Help
Entry
SAPIG1683         CDS       T02071                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sug03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762979..1765456)
Genome map
AA seq 825 aa AA seqDB search
MSDPTLFDYSMIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDV
YTFKGQVVDHPRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDN
AINDILDDHSVLEKVSGLSKKKQKQIAEQISANQESEKIMIRLHDLGFGPKLSMAIYQFY
LGDTLTILDRNPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEEECIKQG
HTYLPINVVIDLTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEI
KSVQNLFRIKTHTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMT
IHRLIGWNQDTKPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQ
LPSVGPGQVFKDLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSF
INCQANQIPTVVEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDT
REIEFGDVVFRKGDKVLQLVNRPNDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEI
TFTKQDMMELTHAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLL
GDPEAFDIGLKTNGQARLTQLCTLLKNYFNSEDEDMLENTATNDTVASQTTIDDQVEAPM
SSNDSEEVTSDSTKTDTNVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccctacactatttgattattcaatgatcaaaggtactgttgaagcgatattg
tttcaaaacagtgataatttttatacagtgcttaaagtagatactattgaaacaaatgaa
gactttgatacaatgccaactgttgtagggtttcttccgaatattgttgaaggcgatgtc
tacacatttaaagggcaggttgttgatcatccacgttatggtaaacaattaaaagcagaa
acttttgaaaaagaaatgccacaaacgaaagaagcaattataagttatttatcaagtgat
ttgtttaaaggtgtaggtaaaaagacagctcaaaatattgttaatacattaggtgacaat
gcgataaatgatatattagatgaccattcagttctagaaaaagtttcgggattatctaaa
aagaaacagaaacaaattgcagaacaaatttcagcaaatcaagaatctgaaaaaataatg
attcgtttacatgatttagggtttggtcctaaactttcaatggcaatttatcagttttat
ctcggtgatacactgactattttagatcgaaatccatatcaattgatttatgatattaaa
ggtattggttttaataaagcagatcaacttgctagaaatattggtatcgcttataacgat
aatgaacgattaaaagctgcgttgctctatacgttagaagaagaatgtattaaacaggga
catacatatttgcctatcaatgttgttatagatttaacggttgatgtattaaattatcaa
gatgaagaggtcatcgaacctgaaaaattagacgaaatgttgcaatacttaaatgaggaa
aaacgactaattattgacaatgaacaagttgcaattccaagtttgtattattctgaaatc
aaaagtgttcaaaacttattcagaataaagacgcatacaaataaacttacagaaattgaa
cagtcagatttacaaatgcatattggtgaaatagaagatgcgaatcaagtgaactatgca
gcttcacaaaaagaagctttgcaaacggctatcaattctaaggtgatgctattaaccggt
ggaccgggaacaggaaagacgacagtaattaaaggcattgtagaattatatgctgagatt
catggcttatcattagattatgatgattatgtcaatgatgattatccagttgtattagca
gcgccaacaggaagagcgtccaagagactacaagagtcaactggattagaagctatgacg
attcatcgtttaataggttggaatcaagacacaaagccagaggatatattagaaaatgaa
ataaacgcacgacttataatcattgatgagatgtctatggtagatacttggttgttccac
caatttttaagtgcagttcctttagatgcacaattgatatttgtaggtgatgaggaccaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgaatcgaaagctatacca
cgagttaatctgactgaagtatatcgtcaacaagatggttcaagcattatagaattagca
catcgaatgaagttgggtcagaaaattgatattacacagcgttttcatgatagaagtttt
attaactgtcaggcaaaccaaataccaacagttgttgagaaggtagttactagtgctgtt
aataaagggtatactatggctgatattcaagtgcttgcaccaatgtataaaggaaatgct
ggtattaaacgtttaaatcaagttttacaagatattttaaaccctaaaaagaaagacaca
cgtgaaattgagtttggtgatgtagtctttagaaaaggtgacaaagtattacaacttgtt
aataggccaaatgataacatatttaatggtgacataggagttattgttggtattttttgg
gcgaaagaaaatgcccttaataaagatgtgcttgttgtggattttgaaggtaatgaaatt
acatttacgaaacaagatatgatggaattaacacatgcatattgtacatcaatccataaa
tcgcaaggttcagaatttcctattgttatcatgcctattgttaaacagtattttagaatg
ttacaaagaccgatattatatactggtttaactagagcgaaaacgagtttagttttactt
ggtgatccagaagcatttgatattggattgaaaacaaatggtcaagcgcgtttaacacaa
ttatgtacattgttgaaaaattattttaattcagaagatgaagacatgctggaaaacaca
gcaactaatgatacagtagcttcacaaacgacaatagatgatcaagtagaagcgccaatg
tcatcgaatgatagtgaagaagttacgtctgattcaacaaaaacagatacaaatgtatta
acggaagctacaatgtttaaaattgacccaatgattaatatgggagaaatcacgccatat
gactttatagaacgttga

DBGET integrated database retrieval system