KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1705Help
Entry
SAPIG1705         CDS       T02071                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase RuvA (EC:3.6.1.-)
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sug00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAPIG1705 (ruvA)
Enzymes [BR:sug01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAPIG1705 (ruvA)
DNA repair and recombination proteins [BR:sug03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAPIG1705 (ruvA)
    RecFOR pathway proteins
     SAPIG1705 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1790812..1791414)
Genome map
AA seq 200 aa AA seqDB search
MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
KNKYDSVDEAVKAGLQLVVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtatgtcaaaggtaagttaacacatttatatcctacacacgtagttgttgaa
actgctggtgttggttatgaaattcaaacaccaaattcttatcgttttcaaaagcatcta
gatcatgaagttttaattcatacatctttaattgttcgtgaagatgcacaattattgtat
ggatttagtagtgaagaagagaaagatatgttcttgagtttaattaaagttactggtatt
ggtccgaaatcagctttagctattttagcgacaagtacgcctaatgaagtaaagcgtgcc
attgaaaatgaaaatgatacgtatttaactaaattcccaggaattggtaagaaaacggca
agacagattgttttagatttaaaaggtaaagtgaaaatcactgaagaagatagcgattca
ttattacaagtagacgctacatcgacggtgcaagatcaattcgtgcaagaagcaatgtta
gcgttagaagcattaggttattctaaacgagagcttgcaaaagttgagaaaacgttaaat
aaaaataaatatgactcagttgatgaagctgttaaggcaggtcttcaattagttgtatct
taa

DBGET integrated database retrieval system