KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1705Help
Entry
SAPIG1705         CDS       T02071                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sug00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAPIG1705 (ruvA)
Enzymes [BR:sug01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAPIG1705 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790812..1791414)
Genome map
AA seq 200 aa AA seqDB search
MYAYVKGKLTHLYPTHVVVETAGVGYEIQTPNSYRFQKHLDHEVLIHTSLIVREDAQLLY
GFSSEEEKDMFLSLIKVTGIGPKSALAILATSTPNEVKRAIENENDTYLTKFPGIGKKTA
RQIVLDLKGKVKITEEDSDSLLQVDATSTVQDQFVQEAMLALEALGYSKRELAKVEKTLN
KNKYDSVDEAVKAGLQLVVS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgtatgtcaaaggtaagttaacacatttatatcctacacacgtagttgttgaa
actgctggtgttggttatgaaattcaaacaccaaattcttatcgttttcaaaagcatcta
gatcatgaagttttaattcatacatctttaattgttcgtgaagatgcacaattattgtat
ggatttagtagtgaagaagagaaagatatgttcttgagtttaattaaagttactggtatt
ggtccgaaatcagctttagctattttagcgacaagtacgcctaatgaagtaaagcgtgcc
attgaaaatgaaaatgatacgtatttaactaaattcccaggaattggtaagaaaacggca
agacagattgttttagatttaaaaggtaaagtgaaaatcactgaagaagatagcgattca
ttattacaagtagacgctacatcgacggtgcaagatcaattcgtgcaagaagcaatgtta
gcgttagaagcattaggttattctaaacgagagcttgcaaaagttgagaaaacgttaaat
aaaaataaatatgactcagttgatgaagctgttaaggcaggtcttcaattagttgtatct
taa

DBGET integrated database retrieval system