KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG2219Help
Entry
SAPIG2219         CDS       T02071                                 

Gene name
rocF
Definition
(RefSeq) arginase (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAPIG2219 (rocF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SAPIG2219 (rocF)
   00330 Arginine and proline metabolism
    SAPIG2219 (rocF)
Enzymes [BR:sug01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAPIG2219 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2303015..2303923)
Genome map
AA seq 302 aa AA seqDB search
MTKKKGIDIIGVPSTFGQRKLGVDLGPTAIRYAGLIPRLKQLDLDVNDKGDIKVSAVDIE
KFQSEQNGLRNYDEIIDVTQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLTYRESHFALELLHQSQSVTSMDLVEVNPLIDHNNHTAEQAVSLIGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaaaaggaattgatattattggtgtaccgtcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaactgcgattagatatgcaggtttaataccaagactaaag
caattagaccttgatgttaatgacaaaggggatattaaggtatcagctgtagacattgaa
aaatttcaaagtgaacaaaatggattaagaaactacgatgaaattatagatgttactcaa
aaattaaataaagaagtatcagcatcaattgaaaataacagattccctctagttcttggt
ggagatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggtgaaggtcctaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattggggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgccttagatccacttgaaacgccaggc
acaggtactagagtcttaggcggacttacatatagagaaagtcattttgcgctggaatta
ttacatcagtctcagtcagttacttcaatggacttagttgaagtgaatccacttattgat
cataataaccatactgctgagcaggcagtttcattaattggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system