KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG2568Help
Entry
SAPIG2568         CDS       T02071                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sug01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sug00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sug00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sug00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sug00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2654516..2656480
Genome map
AA seq 654 aa AA seqDB search
MTQITERELKKKYLDLLSQHFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKDKLSTKELNDLTALVYYPEDKLQLIKCDFQNYGQLNVWYITT
IEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDTNEITVYGKT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPCNGN
LLIHGCIPVDENGEMESFEIDGQTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRIVDKELQRKKIRNTNKGKELQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaagagaattaaaaaagaaatatttggatttattatctcaacat
ttcgatactccagaaaagcttgcgactgaaattattaatttagaatctattttagaatta
cctaaaggtacggagcatttcgttagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaattaatgatattttcaaagacaag
ttatcaacgaaagaacttaacgatttgactgcccttgtttactatccagaagacaaattg
caacttattaaatgtgattttcaaaattatggacaattaaatgtttggtatattacgacg
attgaacacctcattcagctaattaaatattgttcttcaaaatatacgcgttcaaaactt
cgacgtgccttgccggagcaatacgttttcatcgtagaagagttattatataagaacaac
gaattcaaaaataaaaaatcttactacgaaacacttgtaaatcaagtgattgagcttaag
caggcggatgatttaattatagggcttgcgtattctgtacaacgcttagtcgtcgatcat
ttacacgttgttggtgatatttatgatcgtggcccgcaaccagataaaatcatggacacg
ctgattaattatcattctctggatattcaatggggtaatcatgatgtgctatgggttggt
gcttatgcagggtctaaagtatgtttagctaatttactacgtatttgtgcacgttatgac
aatctagatatcgttgaagatgcttacggtattaatttaagacctttgctaacattagcc
gaaaaatactatgatgcagataaccctgcttttaaacctaaaaaaagacctgacaaacat
gaacgtttaacacaacgcgaagaaagtcagattactaaaattcatcaagctattgcgatg
attcaattcaaactggaaataccggttattaagcgccgtccaaactttgaaatggacgaa
cgacttgtacttgaaaaagttaattatgatactaatgaaataacagtatacggaaaaaca
tatccattaaaagatacatgcttccaaactgttaaccgtgataacccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctcactttacttaccttgtaatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcattcgaaatt
gatggtcagacatacagtggccaagagttattagatgtgtttgaatatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatccactgatttagtttggtatttatgg
actgggaaatactcttcactatttggtaaacgtgcgatgactacgtttgaacgatacttt
attgcagataaagcttctcataaagaagaaaagaatccgtactatcatcttcgtgaagat
gtgaatatggtgcgtaaaatgctcagtgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaattaatggggaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacattgttgtataattcattcggaatgcaactcgttgcacatcaacaatttaac
gcaaaagaaaaaattctttccgaaggtatcgacgaactgtcaattaaacgtattgttgat
aaagaattacaacgtaaaaaaatccgcaatacaaataaaggtaaagagcttcaggctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system