KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_02350Help
Entry
SAMSHR1132_02350  CDS       T01767                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAMSHR1132_02350
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAMSHR1132_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(287150..288067)
Genome map
AA seq 305 aa AA seqDB search
MKNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFI
TKIGNDGVADFILEDFKEANIDTSYIIKTDEAKTGQAFITVNAEGQNSIYVYGGANMTIT
PEDVETAKDAIVKADFIVAQLEVPIPAIIAAFEIAKAHGVTTVLNPAPAKPLPDKLLSLI
DIIVPNETEAELLSGIKVTDESSMQANADYFLSLGIKTVLITLGKQGTYFATRDHSQHIQ
AYKVKAIDTTAAGDTFIGAFVSRLNKSQDNLEEAIDFGNKASSFTVQRHGSQASIPPLEE
VENKA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagttgttatattaggctctacaaacgtagatcaatttttaacagttgaa
agatatgctcaaccaggcgaaactctacatgttgaggaagctcaaaaagcatttggtggc
ggtaaaggcgctaaccaagcgattgcaactgcacgcatgcaagcagataccacatttatt
acgaaaataggaaatgatggtgttgctgatttcatcttagaagattttaaagaggcaaat
atagatacatcttacattatcaaaactgatgaagctaaaactggccaagcattcattact
gttaatgctgaaggtcaaaattccatctatgtatatggtggtgcaaacatgacaataaca
cctgaagatgtcgaaacagcaaaagatgcaattgttaaagcagactttattgttgctcaa
ttagaagtaccgatacctgccattattgctgcatttgaaattgctaaagcacatggtgta
acaacggtgttaaatccagcaccagcgaagccattgcctgataaactattatcactcatt
gatattatcgttccgaatgaaactgaagctgaattattatccggcatcaaagtaacagat
gaatcatccatgcaagcgaatgcagattactttttatccttaggtatcaaaactgtttta
attacattaggtaaacaaggtacatattttgctacacgagaccatagccaacacattcag
gcttataaagttaaagctatcgatacgactgctgctggcgatacatttatcggtgctttt
gtgagtcgtttaaataagtctcaagataatttagaagaggctatagacttcggtaacaaa
gcaagttcgtttactgttcaaagacatggttctcaagcgtccattcctccattagaagaa
gttgaaaataaagcataa

DBGET integrated database retrieval system