KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_04020Help
Entry
SAMSHR1132_04020  CDS       T01767                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456169..456903
Genome map
AA seq 244 aa AA seqDB search
MRIKTPSPAYLKGTNGHAILLLHSFTGTNRDVKHLAAELNEQGFSCYAPNYPGHGLLLKD
FMAYNVDDWWQEVEQAYQFLVNEGYQSISATGVSLGGLMTLKLAQHYPLARIAVMSAPKE
KSDDGLIEHLVYYSQRMANILNLDQQAADAQLAAIKDYNAEITKFQHFIDDIMSHLYTIK
IPANILFGGKDDPSYETSAHFIYEHLGSEEKELNGLEDSHHLMTHGEGRELLEANIIRFF
NKLK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaaaacaccgagtcctgcttatttaaaaggaacaaacggacacgcaatatta
ttactgcattcattcacaggtacaaatcgagatgtgaagcatcttgcagcagaattaaat
gaacaaggatttagctgttatgctcccaattatcctggacatggtttattgttaaaagat
tttatggcatataatgtggacgattggtggcaagaagttgagcaagcttaccaattttta
gtcaatgaaggttatcaatctattagtgctacaggcgtctcattaggtggtctaatgaca
ttaaaattagcacaacattatccattggctcgtattgctgtgatgtcagcaccgaaagaa
aagagtgacgatggcttaattgaacatttagtttattatagtcaacgcatggctaatatt
ttaaatttagatcagcaagcagcggatgcacaattagcggcgatcaaagattataatgct
gagattacgaagttccaacattttattgatgatatcatgtcgcatttatatacgattaaa
ataccggccaatatattattcggtggcaaagatgatccatcttatgaaacaagtgctcat
tttatatatgaacatttaggctcagaagagaaagaattaaatggtcttgaagattcacat
catttgatgacgcatggagagggtagagagttattagaggccaatatcattcgcttcttt
aataaattaaaataa

DBGET integrated database retrieval system