KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_04580Help
Entry
SAMSHR1132_04580  CDS       T01767                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:suh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524413..525216
Genome map
AA seq 267 aa AA seqDB search
MTKTEIMGILNVTPDSFSDGGKFNDVESAINRVKCMMDEGVDIIDVGGVSTRPGHEMITL
EEEINRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMINDQWAGLYDKRMFQVVAK
YDAEIVLMHNGNGERDEPVIEEMLTSLLAQAHQAKLAGIRADKIWLDPGIGFAKTRDEEA
EVMSRLDELVATEYPILLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVKAVRV
HNVGLNAKLAKGIDFLKENENGRQNLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacagaaattatgggcatattaaatgttacacctgattcattttcagatggt
ggtaaatttaacgatgttgaatctgcaataaatagggtgaagtgcatgatggatgaaggt
gttgatatcatagatgttgggggtgtttcgacacgaccaggacatgaaatgattactttg
gaagaagagattaatagagttttaccagtcgttgaggcaattgttggttttgatgtaaaa
atttcagttgatacatttagaagtgaagttgctgaggcatgcttgaagttaggcgtagat
atgattaatgatcaatgggcggggctctatgataaacgaatgtttcaagttgttgctaaa
tatgatgcagaaatagttttaatgcataatggtaatggtgagcgtgatgaaccagttatc
gaagaaatgcttacttcattgttggcccaggcgcatcaagctaaacttgcaggaattcgt
gcagataaaatatggcttgatccgggaattggtttcgctaaaactagagatgaagaagcg
gaagtaatgtcaagactggatgaacttgtagctacggagtatcctattttattagcaacc
agccgaaagagatttacaaaagagatgatgggttatgatacaacgccagttgaaagagat
gaagtgactgctgctacgacagcttatggtattatgaaaggcgttaaagcagtacgcgta
cacaatgttgggttaaatgcgaaactagctaaaggtatagattttttaaaggagaatgaa
aatggaagacaaaatctttcttaa

DBGET integrated database retrieval system