KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_04600Help
Entry
SAMSHR1132_04600  CDS       T01767                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAMSHR1132_04600
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SAMSHR1132_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525556..526035
Genome map
AA seq 159 aa AA seqDB search
MIQAYLGLGSNIGDRENQLNEAIKMLNEYDGIDVLKVSSIYETAPVGYTEQPNFLNLCIG
IETTLSVSELLERCLDVEARLHRVRKERWGPRTIDVDILLYGNEITELPNLSVPHPRMNE
RAFVLIPLNDIATDVIEPRSNLKIKDLVPNDESVVLYKL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcatatttaggtttaggtagtaatattggtgacagagaaaatcaacttaat
gaagctataaagatgttgaacgaatatgatggtatcgatgtattaaaggtttcttcgata
tatgaaactgcaccagtaggctataccgagcagcctaactttttgaatttatgtattgga
attgaaacaacactttcagtatcagaattattagaacgttgcttagatgtcgaagcgcgt
ttacatcgtgttaggaaagagcgatggggtccaaggacaatagatgtagatattttatta
tacgggaatgaaattacagaattgccgaatctttcagtaccacatccaagaatgaatgaa
cgtgcatttgttttaattcctttaaatgatattgctacagatgttatagaacctcgttcg
aatctgaaaataaaggatttagtacctaatgatgaaagcgtagtattgtataagctgtaa

DBGET integrated database retrieval system