KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_04720Help
Entry
SAMSHR1132_04720  CDS       T01767                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:suh00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAMSHR1132_04720
Enzymes [BR:suh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SAMSHR1132_04720
Amino acid related enzymes [BR:suh01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SAMSHR1132_04720
Transfer RNA biogenesis [BR:suh03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SAMSHR1132_04720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
547502..548956
Genome map
AA seq 484 aa AA seqDB search
MSDRIRVRYAPSPTGYLHIGNARTALFNYLFAKHYNGDFVIRIEDTDKKRNLEDGEASQF
DNLKWLGLDWDESVDKDKGFGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE
AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTFAFDDMVKGNISFDSN
GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG
HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGEEEIFSKDEF
IKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPDLVKANLIPENPSEEDL
EWGRKLIGLYQKEMSYAGEIVPLSEMFFKEMPALGEEEQQVIDGEQVPELMTHLYSKLEA
LEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVLNRL
KQYI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgcataagagtaagatatgcaccaagtccaactggataccttcatattggt
aacgcaagaactgcgttatttaattacttatttgctaaacattacaatggagatttcgtt
atccgtattgaagatacggataaaaaacgtaacctagaagacggtgaagcatcacaattt
gataatttaaaatggttaggtttagattgggatgagtcagtagataaagataaaggattc
ggaccataccgtcaatctgagcgtcaacatatttatcaaccattaatagatcaattatta
gcggaagacaaagcttataaatgttatatgactgaagaagagttggaagctgaacgtgaa
gctcaaatcgcacgtggtgaaatgcctcgttacggcggacagcatgcacatttgactgaa
gaacaacgtcaacaatttgaagctgaaggacgtcagccttctatacgtttccgagtacct
caaaatcaaacttttgcatttgatgatatggttaaaggaaatatttcatttgattcaaat
ggtattggagactgggtaatcgttaaaaaagacggaataccaacatataacttcgcggta
gctattgatgatcactatatggaaatttcagatgtcattcgtggcgatgatcatatttct
aatacacctaaacaaatcatgatttatgaagcatttggatgggaaccacctcgttttggt
catatgtctttaattgtaaatgaagaacgtaaaaagttaagtaagcgtgatggacaaatt
ttacaatttattgagcagtatcgtgatttaggctatttaccagaagcattatttaatttt
attgcgttattaggatggtctccagaaggcgaagaagaaatcttctcaaaagatgagttt
atcaaaatctttgatgaaaagcgtttatcaaaatcaccagcatttttcgataagcaaaaa
ttggcttgggtaaataatcaatatatgaaacaaaaagatactgaaacagtattccaatta
gcattaccagacttagttaaagcaaatttaatacctgaaaatccatctgaagaagattta
gaatggggacgtaagcttataggtctttatcaaaaagaaatgagctatgcaggtgaaatt
gtacctttatcagaaatgttctttaaagaaatgccggcgttaggtgaagaagagcaacaa
gtaattgatggcgaacaagttccagaattaatgactcacttatatagtaaactagaagcg
cttgaaccatttgaagcggcagaaattaaaaagacaattaaagaagttcaaaaagaaaca
ggtattaaaggtaaacaattatttatgcctattcgtgttgctgtaactggtcaaatgcat
ggacctgaattacctaatactattgaagtacttggtaaagaaaaagtattgaatcgtcta
aaacagtacatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system