KEGG   Staphylococcus argenteus: SAMSHR1132_05480Help
Entry
SAMSHR1132_05480  CDS       T01767                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00071  Fatty acid degradation
suh00350  Tyrosine metabolism
suh00625  Chloroalkane and chloroalkene degradation
suh00626  Naphthalene degradation
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_05480
  Lipid metabolism
   00071 Fatty acid degradation
    SAMSHR1132_05480
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAMSHR1132_05480
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAMSHR1132_05480
   00626 Naphthalene degradation
    SAMSHR1132_05480
Enzymes [BR:suh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAMSHR1132_05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C BKACE Methyltransf_11 ADH_N_2 Methyltransf_25 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: CCE58405
UniProt: W8TNS8
Position
636087..637097
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSVKNAGYTVDGAMAEQ
VIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQWLGVFGIGGLGNLALQY
AKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVMKLTDNKGLDATVVTSVA
KTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEVVGSLVGTRQDLREAFEFAA
ENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagttgtaacgaaagatcacaaagtaagtattgaggacaaaaagttaaga
gctttaaaacctggtgaagcactggtacaaacagaatattgtggcgtttgtcatactgat
ttacatgttaagaatgctgattttggtgatgttacaggcgttactttaggtcatgaaggt
attggtaaagtcatcgaagttgcagaagatgtagaatcattaaaaattggagaccgtgtg
tctatcgcttggatgttcgaaagctgtggaagatgtgaatattgtacaacaggtcgtgaa
acactttgccgtagtgtgaaaaatgctggttatacagtggatggtgcaatggctgaacaa
gttattgttactgcagactatgctgtgaaagtacctgaaaaattagatccagcagctgcg
tcttctattacatgcgcaggtgtgactacttataaagctgtaaaagtaagtaatgtaaaa
cctggacaatggttaggtgtttttggtataggtggtttaggtaacctagctttacaatat
gctaaaaacgttatgggggctaaaattgttgcctttgacatcaatgatgataaattagca
ttcgcgaaagaattaggtgctgatgctattattaattctaaagatgttgatccagttgca
gaagttatgaaattaactgataacaaaggattagatgcaacagtggtaacttcagttgct
aagacaccatttaaccaagcggttgatgttgtaaaagctggtgcaagagttgttgccgtt
ggtttacctgttgataaaatgaacttagatatcccaagattagtgcttgatggtattgaa
gtagtaggttcacttgttggtacaagacaagacttacgtgaagcgtttgaatttgctgct
gaaaataaagtaacacctaaagttcaattaagaaaattagaagaaatcaatgatattttt
gaagaaatggaaaatggtacaataactggtagaatggttattaaattttaa

DBGET integrated database retrieval system