KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_07200Help
Entry
SAMSHR1132_07200  CDS       T01767                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAMSHR1132_07200
   01230 Biosynthesis of amino acids
    SAMSHR1132_07200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_07200
   00051 Fructose and mannose metabolism
    SAMSHR1132_07200
   00562 Inositol phosphate metabolism
    SAMSHR1132_07200
Enzymes [BR:suh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAMSHR1132_07200
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAMSHR1132_07200
  Exosomal proteins of bladder cancer cells
   SAMSHR1132_07200
  Exosomal proteins of melanoma cells
   SAMSHR1132_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818620..819381
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVKEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANNVVGEQVKKAVAGLSEDQLKATVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaataatagctggtaactggaaaatgaacaaaacagtaaaagaagctaaa
gacttcgttaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcatttacaggcgaaaca
tcacctgttgcattagctgatttaggcgtgaagtacgttgttatcggacattctgaacgt
cgtgaattattccatgaaactgatgaagaaatcaacaaaaaagcgcacgcgattttcaaa
catggtatgactccaattatttgtgttggtgaaactgatgaagaacgtgaaagtggcaaa
gctaacaatgttgtaggtgaacaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaagcaactgtgattgcttatgagccaatctgggcaataggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaacaattgctgacctatca
agcaaagaagtatcagaagctacacgtattcaatatggtggtagtgtaaaacctaacaac
attaaagaatatatggcacaaactgatatcgatggtgcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system