KEGG   Staphylococcus argenteus: SAMSHR1132_07200Help
Entry
SAMSHR1132_07200  CDS       T01767                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00051  Fructose and mannose metabolism
suh00562  Inositol phosphate metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
suh01230  Biosynthesis of amino acids
Module
suh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suh_M00002  Glycolysis, core module involving three-carbon compounds
suh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_07200
   00051 Fructose and mannose metabolism
    SAMSHR1132_07200
   00562 Inositol phosphate metabolism
    SAMSHR1132_07200
Enzymes [BR:suh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAMSHR1132_07200
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAMSHR1132_07200
  Exosomal proteins of bladder cancer cells
   SAMSHR1132_07200
  Exosomal proteins of melanoma cells
   SAMSHR1132_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCE58575
Position
818620..819381
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVKEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANNVVGEQVKKAVAGLSEDQLKATVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIADLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaataatagctggtaactggaaaatgaacaaaacagtaaaagaagctaaa
gacttcgttaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcatttacaggcgaaaca
tcacctgttgcattagctgatttaggcgtgaagtacgttgttatcggacattctgaacgt
cgtgaattattccatgaaactgatgaagaaatcaacaaaaaagcgcacgcgattttcaaa
catggtatgactccaattatttgtgttggtgaaactgatgaagaacgtgaaagtggcaaa
gctaacaatgttgtaggtgaacaagttaagaaagctgttgcaggtttatctgaagatcaa
cttaaagcaactgtgattgcttatgagccaatctgggcaataggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaacaattgctgacctatca
agcaaagaagtatcagaagctacacgtattcaatatggtggtagtgtaaaacctaacaac
attaaagaatatatggcacaaactgatatcgatggtgcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system