KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_07250Help
Entry
SAMSHR1132_07250  CDS       T01767                                 

Definition
putative carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Brite
Enzymes [BR:suh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAMSHR1132_07250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823556..824296
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGTIYEGFLEYARNFKKYEGKDQETIDNEMNHFKPTETLKELSEALDTIKGQVDEVLD
PILVIQAENDKMIDPQSANYIYDHVDSDDKTIKWYSESGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaattaccaaaacctttcttttttgaagaaggcaaacgtgccgtgttatta
ttacatggatttacaggcaattcgtctgatgtacgtcaattaggtcgatttttacaaaaa
aaggggtatacttcgtatgcaccacaatatgaaggtcacgcagcaccacccgaggaaata
ttgaaatcaagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgtagctggtctatcattaggtggggattttgcttta
aaattaagcttaaatcgtgatgtaaagggtattgtaacgatgtgtgcaccaatgggtggt
aaaactgaaggtaccatttatgaaggctttttagagtatgcacgtaattttaaaaagtat
gaaggtaaagatcaagagactattgataatgaaatgaatcattttaaaccaactgaaact
ttaaaagaacttagtgaagcattagatacgattaaaggtcaagttgatgaagtgttggat
cctattttagtgattcaagcagaaaacgacaaaatgattgatccacaatccgcaaattat
atatatgaccatgtagattcggatgataaaactatcaagtggtatagtgaatctggacat
gttattacaattgataaagagaaagaacaagtatttgaagatatttatcaatttttagag
tcattagattggtcagaataa

DBGET integrated database retrieval system