KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_09420Help
Entry
SAMSHR1132_09420  CDS       T01767                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAMSHR1132_09420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_09420
   00020 Citrate cycle (TCA cycle)
    SAMSHR1132_09420
   00620 Pyruvate metabolism
    SAMSHR1132_09420
Enzymes [BR:suh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SAMSHR1132_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051305..1052597
Genome map
AA seq 430 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVV
VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSAKEEPAKEEAPAEQAPVAAQTEEVDE
NRTVKAMPSVRKYAREKGVNIKAVPGSGKNGRITKEDVDAYLNGGAPAATNESAASTSTE
EVDETPAAPAAVSLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
NNPELLLMEG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgatatcggggaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatactattgaagaagacgatgttttagcagaagtacaa
aacgacaaatcagtagtagaaattccttcaccagtttctggtactgtagaagaagtagtt
gttgaagaaggtacagtagctgtagttggtgatgtaattgttaaaattgatgcaccagat
gcagaagacatgcaatttaaaggtcatgatgatgattcatcagctaaagaagaaccagct
aaagaggaagcgccagctgagcaagcaccagtagcagctcaaactgaagaagtagatgaa
aacagaactgtaaaagcaatgccatcagtgcgtaaatacgctcgtgaaaaaggtgttaac
attaaagcagttccaggttcaggtaaaaatggacgtattactaaagaagatgttgatgca
tacttaaatggtggtgcaccagcagctactaatgaatcagctgcttcaacttcaactgaa
gaagttgatgaaacaccagcagcgcctgcagcagtatcattagaaggtgacttcccagaa
acaactgaaaaaatcccagctatgcgtagagcaattgcaaaagcaatggttaactctaaa
catactgcgcctcacgtaacattaatggatgaaattgatgtacaagcattatgggatcac
cgtaagaaattcaaagaaatcgcagctgaacaaggaactaaattaacattcttaccttat
gttgttaaagcacttgtttctgcattgaaaaaatacccagcacttaacacttcattcaat
gaagaagctggtgaaatcgttcataaacattactggaatatcggtattgcagcagacact
gatagaggattattagttcctgttgttaaacatgctgatcgtaagtctattttccaaatt
tcagatgaaattaatgagttagctgttaaagcacgtgatggtaaattaacagccgatgaa
atgaaaggtgcaacatgcacaatcagtaatatcggttcagctggtggacaatggttcact
ccagttatcaatcacccagaagtagcaatcttaggaataggccgtattgctcaaaaacca
atcgttaaagatggtgaaattgttgctgcaccagtattagcattatcattaagctttgac
cacagacaaatcgatggtgcaactggacaaaatgcaatgaatcacattaaacgtttatta
aataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system