KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_09850Help
Entry
SAMSHR1132_09850  CDS       T01767                                 

Definition
phenylalanyl-tRNA synthetase subunit beta (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:suh00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094141..1096543
Genome map
AA seq 800 aa AA seqDB search
MLISNEWLKEYVTVNDSVSNLAERITRTGIEVDDLIDYTKDIKNLVVGYVESKAKHPDAD
KLNVCQVDIGEEEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
SLQEIGISSNYVPKNYESGIYVFNEKQVPGSDALEALYLNDQVMEFDLTPNRADALSMIG
TAYEVAALYNTKMTKPETASNELDLSANDELTVKIENEEKVPYYSARVVHDVTIAPSPIW
MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDN
VERNLLTSDIVITNGQTPIALAGVMGGDFSEVKDHTTNIVVEGAIFDPVSIRHTSRRLNL
RSESSSRFEKGIATEFVNEAVDRACYLLQTYANGKVLKDTVASGNLGALITPIDITAEKI
NRTIGFDLTQSDIVTIFNQLGFETNLNGDVITVKVPSRRKDITIKEDLIEEVARIYGYDD
IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKENATAFAMQQRETI
DLLMPMSEAHSSLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGKLPDQVEYL
SGILTGDYVVNQWQGKKEVVDFYLAKGVVDRVAEKLNLVFEYRRANIDGLHPGRTAEILL
DNEVVGFIGELHPTLAADNDLKRTYVFELNFDVLMSVPVGYINYQPIPRFPGMSRDIAME
VDQNIPAADLLATIHEHGGKILHDTLVFDVYQGDHLEKGKKSIAIRLNYLDTEETLTDER
VSKVQDKIEAALIEQGAVIR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgttgatatcaaacgaatggttgaaagaatatgtaacagtaaatgattctgtttctaat
ttagcagaacgtattacacgtacaggaatagaagttgatgatttaattgactacactaaa
gatattaaaaacttagtcgtaggatatgttgagtcaaaagcaaagcatcctgatgctgat
aaattaaatgtgtgtcaagtagatatcggtgaggaagaaccagtacaaattgtatgtggt
gcaccgaatgttgatgcaggacagtatgttatagttgcaaaagttggtggcagattacct
ggtggtattaaaattaaacgtgccaaattacgtggtgagcgttcagaaggtatgatttgt
tcacttcaagaaattggaatctctagtaattatgtacctaaaaattatgaatctggcatt
tacgtatttaatgaaaaacaagttccagggtcagatgcattggaagctttatatttaaat
gaccaagtaatggaatttgatttaacaccaaacagagctgatgcattaagtatgattggt
acggcatatgaagttgctgcattatataatacaaaaatgacgaagccagagacagcatca
aatgagcttgatttatctgcaaatgatgaattgactgtgaagattgaaaatgaagaaaaa
gtaccatattatagtgcgcgtgttgttcatgatgtcacaattgctccttcaccgatatgg
atgcaagcgagacttataaaagccggtatccgtccgattaataatgttgtcgacatttct
aattatgtgctattggaatacggtcaaccattacatatgtttgaccaagatgcgatagga
tcacaacaaatcgttgtacgtcaagctaatgaaggcgaaaaaatgacaacattagataat
gtagagcgtaatttattaacaagcgatatcgttattacaaacggtcagacaccaattgct
ttagcaggtgtaatgggtggcgacttctctgaagttaaagatcacacgactaatattgtt
gtagaaggtgcaatttttgatcctgtttcaattcgtcatacttcaagacgtttaaattta
cgtagtgagtcatcaagtcgttttgaaaaaggtattgcgacagaatttgtaaacgaagcc
gttgacagagcgtgttatttattacaaacatacgcaaacggtaaagtattaaaagatact
gtggcatctggaaatctaggtgctttaatcacacctatcgatattactgctgaaaaaatt
aatcgaacaattggttttgatttgacgcaaagtgatattgtgactatttttaatcaatta
gggtttgaaactaatttaaatggcgatgtgattactgtaaaagtgccatcacgtcgtaaa
gatattacgattaaagaagatttaattgaagaagttgcacgtatttatggttatgatgac
attccttcaacattaccagtatttgataaagtaacgagcggacagttaacggatcgtcaa
tataaaacaagaatggttaaagaagtcttagaaggtgctggattagatcaagcgattacg
tattcattagtatcgaaagaaaatgcaacagcatttgcgatgcaacaacgtgagacgatt
gatttattaatgccaatgagtgaggcacattcttcactacgacaaagtttattaccacac
ttaattgaagcggcttcttataatgtggcgcgtaaaaataaagatgtaaaattatttgaa
attggaaatgtcttctttgcaaatggcgaagggaaattaccagatcaagttgaatatttg
agtggtatattaacaggtgattatgttgtgaaccaatggcaagggaagaaagaggttgtc
gatttttatttagcgaaaggtgttgtagatcgagtagctgaaaaattaaaccttgttttt
gaatatcgtcgagcgaatattgatggcttgcaccctggtcgcactgctgaaattttatta
gataatgaagtagttgggtttatcggtgaattacatcctactttagctgctgataatgat
ttgaaacgcacatatgtttttgaattgaactttgatgtgttaatgtcagtacctgttggt
tacattaactatcagcctatacctagattcccaggcatgtctcgtgatattgctatggaa
gtggatcaaaatattccagcagctgatttattagctacgattcatgaacatggtgggaaa
attttacatgatacacttgtatttgatgtataccaaggtgatcatttagaaaaaggtaag
aaatctattgcgatacgtttgaattatttagatacagaggaaacattaacagatgaacgt
gtttctaaagtacaagataaaattgaagcagctttaattgagcaaggtgctgttatcaga
taa

DBGET integrated database retrieval system