KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_09850Help
Entry
SAMSHR1132_09850  CDS       T01767                                 

Definition
phenylalanyl-tRNA synthetase subunit beta (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:suh00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAMSHR1132_09850
Enzymes [BR:suh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     SAMSHR1132_09850
Amino acid related enzymes [BR:suh01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   SAMSHR1132_09850
Transfer RNA biogenesis [BR:suh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SAMSHR1132_09850
 Prokaryotic Type
    SAMSHR1132_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094141..1096543
Genome map
AA seq 800 aa AA seqDB search
MLISNEWLKEYVTVNDSVSNLAERITRTGIEVDDLIDYTKDIKNLVVGYVESKAKHPDAD
KLNVCQVDIGEEEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC
SLQEIGISSNYVPKNYESGIYVFNEKQVPGSDALEALYLNDQVMEFDLTPNRADALSMIG
TAYEVAALYNTKMTKPETASNELDLSANDELTVKIENEEKVPYYSARVVHDVTIAPSPIW
MQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLDN
VERNLLTSDIVITNGQTPIALAGVMGGDFSEVKDHTTNIVVEGAIFDPVSIRHTSRRLNL
RSESSSRFEKGIATEFVNEAVDRACYLLQTYANGKVLKDTVASGNLGALITPIDITAEKI
NRTIGFDLTQSDIVTIFNQLGFETNLNGDVITVKVPSRRKDITIKEDLIEEVARIYGYDD
IPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKENATAFAMQQRETI
DLLMPMSEAHSSLRQSLLPHLIEAASYNVARKNKDVKLFEIGNVFFANGEGKLPDQVEYL
SGILTGDYVVNQWQGKKEVVDFYLAKGVVDRVAEKLNLVFEYRRANIDGLHPGRTAEILL
DNEVVGFIGELHPTLAADNDLKRTYVFELNFDVLMSVPVGYINYQPIPRFPGMSRDIAME
VDQNIPAADLLATIHEHGGKILHDTLVFDVYQGDHLEKGKKSIAIRLNYLDTEETLTDER
VSKVQDKIEAALIEQGAVIR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgttgatatcaaacgaatggttgaaagaatatgtaacagtaaatgattctgtttctaat
ttagcagaacgtattacacgtacaggaatagaagttgatgatttaattgactacactaaa
gatattaaaaacttagtcgtaggatatgttgagtcaaaagcaaagcatcctgatgctgat
aaattaaatgtgtgtcaagtagatatcggtgaggaagaaccagtacaaattgtatgtggt
gcaccgaatgttgatgcaggacagtatgttatagttgcaaaagttggtggcagattacct
ggtggtattaaaattaaacgtgccaaattacgtggtgagcgttcagaaggtatgatttgt
tcacttcaagaaattggaatctctagtaattatgtacctaaaaattatgaatctggcatt
tacgtatttaatgaaaaacaagttccagggtcagatgcattggaagctttatatttaaat
gaccaagtaatggaatttgatttaacaccaaacagagctgatgcattaagtatgattggt
acggcatatgaagttgctgcattatataatacaaaaatgacgaagccagagacagcatca
aatgagcttgatttatctgcaaatgatgaattgactgtgaagattgaaaatgaagaaaaa
gtaccatattatagtgcgcgtgttgttcatgatgtcacaattgctccttcaccgatatgg
atgcaagcgagacttataaaagccggtatccgtccgattaataatgttgtcgacatttct
aattatgtgctattggaatacggtcaaccattacatatgtttgaccaagatgcgatagga
tcacaacaaatcgttgtacgtcaagctaatgaaggcgaaaaaatgacaacattagataat
gtagagcgtaatttattaacaagcgatatcgttattacaaacggtcagacaccaattgct
ttagcaggtgtaatgggtggcgacttctctgaagttaaagatcacacgactaatattgtt
gtagaaggtgcaatttttgatcctgtttcaattcgtcatacttcaagacgtttaaattta
cgtagtgagtcatcaagtcgttttgaaaaaggtattgcgacagaatttgtaaacgaagcc
gttgacagagcgtgttatttattacaaacatacgcaaacggtaaagtattaaaagatact
gtggcatctggaaatctaggtgctttaatcacacctatcgatattactgctgaaaaaatt
aatcgaacaattggttttgatttgacgcaaagtgatattgtgactatttttaatcaatta
gggtttgaaactaatttaaatggcgatgtgattactgtaaaagtgccatcacgtcgtaaa
gatattacgattaaagaagatttaattgaagaagttgcacgtatttatggttatgatgac
attccttcaacattaccagtatttgataaagtaacgagcggacagttaacggatcgtcaa
tataaaacaagaatggttaaagaagtcttagaaggtgctggattagatcaagcgattacg
tattcattagtatcgaaagaaaatgcaacagcatttgcgatgcaacaacgtgagacgatt
gatttattaatgccaatgagtgaggcacattcttcactacgacaaagtttattaccacac
ttaattgaagcggcttcttataatgtggcgcgtaaaaataaagatgtaaaattatttgaa
attggaaatgtcttctttgcaaatggcgaagggaaattaccagatcaagttgaatatttg
agtggtatattaacaggtgattatgttgtgaaccaatggcaagggaagaaagaggttgtc
gatttttatttagcgaaaggtgttgtagatcgagtagctgaaaaattaaaccttgttttt
gaatatcgtcgagcgaatattgatggcttgcaccctggtcgcactgctgaaattttatta
gataatgaagtagttgggtttatcggtgaattacatcctactttagctgctgataatgat
ttgaaacgcacatatgtttttgaattgaactttgatgtgttaatgtcagtacctgttggt
tacattaactatcagcctatacctagattcccaggcatgtctcgtgatattgctatggaa
gtggatcaaaatattccagcagctgatttattagctacgattcatgaacatggtgggaaa
attttacatgatacacttgtatttgatgtataccaaggtgatcatttagaaaaaggtaag
aaatctattgcgatacgtttgaattatttagatacagaggaaacattaacagatgaacgt
gtttctaaagtacaagataaaattgaagcagctttaattgagcaaggtgctgttatcaga
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system