KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_10410Help
Entry
SAMSHR1132_10410  CDS       T01767                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAMSHR1132_10410
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAMSHR1132_10410
Enzymes [BR:suh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SAMSHR1132_10410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155928..1156812
Genome map
AA seq 294 aa AA seqDB search
MNHLLSMEHLSTDQIYSLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLENINIPIANA
GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
PDAWIDDSLKAPYVNIDDVIEKVDIVMLLRIQHERHGLAEEARFAADDYHQKHGLNEARY
NKLQAHAIVMHPAPVNRGVEIQTDLVEASKSRIFKQMENGVYLRMAVIDELLNK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttattatcaatggaacatttatcaacagatcaaatctactcacttattcaa
aaggctagtcaatttaaatctggtgaacgtcaattaccaaactttgaagggaaatatgtt
gcgaatttgttctttgaaaattcaactcgaacaaaatgtagttttgaaatggcagaactt
aaattaggattgaaaacaattagttttgaaacttctacgtcatcagtttctaaaggagaa
tccttatatgatacatgtaaaacattggaaagtattggttgcgatttactagttattaga
catccatttaataactactatgagaaattagagaatatcaatattccaattgcaaatgct
ggtgatggaagtggacaacatccaacacaaagtttacttgacttaatgacaatttatgaa
gagtacggttatttcgaaggattaaatgtattgatatgtggagatataaaaaattcacgc
gtcgcacgcagtaactatcatagtttaaaggcattaggagcaaacgtaatgtttaatagt
cctgatgcgtggattgatgattcattaaaagcaccctatgtcaatattgacgatgtaatt
gaaaaagtagacatcgttatgctactaagaattcaacatgaaagacatggacttgctgaa
gaggcgagattcgcagcagacgattatcatcaaaagcatggtttaaacgaagcacgatat
aacaaattacaagcgcatgcaattgttatgcatccagctccagttaatagaggcgtagag
atacaaactgatttagttgaagcttcaaaatcaagaattttcaaacaaatggaaaatggc
gtgtacttaagaatggcagtcattgatgaattattaaataagtaa

DBGET integrated database retrieval system