KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_10500Help
Entry
SAMSHR1132_10500  CDS       T01767                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:suh00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167028..1167651
Genome map
AA seq 207 aa AA seqDB search
MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPTTSYKYSISMTTRQMREGEVDGVDYFFKTR
DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
FIFLAPPSLDHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
QCIVEAEHLKRERVEAKYRKMILEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaaaaaggattgttaatcgttttatcagggccatctggagtcggtaaaggt
actgttagaaaacgaatatttgaagatccaactacatcatataagtattctatttcaatg
acaacacgccaaatgcgcgaaggcgaagttgatggcgtagattacttttttaaaacaagg
gatgcgtttgaagctttaattaaagatgatcaatttatagaatatgccgagtatgttggc
aactattatggtacaccagttcaatatgttaaagatactatggacgaaggacatgatgta
tttttagaaattgaagtagagggtgcaaagcaagttagaaagaaatttcctgatgcgtta
tttatattcttagcacctccaagtttagatcacttgagagagcgattagtaggaagaggc
acagaatctgacgaaaaaattcaaagtcgcattaacgaagcacgtaaagaagttgaaatg
atgaacttatatgattacgtagtagttaatgatgaagttgaacttgcaaaaaatagaatt
caatgtattgtagaagctgagcacttaaaaagagagcgcgtagaagctaagtatcgaaaa
atgattttggaggcaaaaaaataa

DBGET integrated database retrieval system