KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_11420Help
Entry
SAMSHR1132_11420  CDS       T01767                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SAMSHR1132_11420
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SAMSHR1132_11420
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMSHR1132_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275523..1277019
Genome map
AA seq 498 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNQKGEISGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
DYSNASRTLMFNIHDLKWDDELLELLTVPKNMLPEVKPSSEIYGKTIDYHFYGQEVPIAG
VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGEKAVKSDSGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
QADIVNTSVERPEIQETTALGAAYLAGLAVGFWDSKDDIAKNWKLEEKFDPKMDEGEREK
LYRGWKKAVEATQVFKTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatacattttatcaatagaccaaggaacaacaagttcaagagcaattttattt
aatcaaaaaggtgaaatttcaggggtagcacagcgtgaatttaaacagtattttcctcaa
tcaggttgggtcgaacatgatgcgaatgaaatttggacatctgttttagcagttatgact
gaagttattaatgaaaatgatgttagagctgatcaaattgcaggtattggtattacaaac
caacgtgaaacaacagtagtttgggataaacatacgggacgtccaatttatcatgcaatt
gtatggcaatctcgtcaaacacaatcgatttgttcagaattgaaacaacaaggttatgag
caaacgtttagagataaaacaggattgttgttagatccatattttgcgggaactaaagtc
aaatggattttagataatgtagaaggcgctcgtgaaaaagcagaaaatggagatttattg
tttggaacaattgatacttggttagtttggaaattatcaggtaaagctgcacatattaca
gattattcaaatgcgagtcgtacgttaatgtttaatatccatgatttaaaatgggacgac
gaattattagaattattaacagttcctaaaaatatgttgccagaagttaaaccttctagt
gaaatttatggaaaaacaattgattatcatttctatggtcaagaagtgccaattgcaggg
gtagctggagaccaacaagcagcattgttcgggcaagcatgctttgagcgtggagatgtg
aaaaacacatatggcactggtggatttatgttgatgaatactggtgaaaaagcagttaag
tctgatagtgggctattaacaacaattgcatatggtattgatggcaaagtaaactatgcg
cttgaaggatcgatttttgtatccggttcagcaattcaatggttacgtgatggtttaaga
atgattaattctgcgcctcaatcagaaagttatgcgacaagagtagactctactgaaggt
gtatatgttgtacctgcctttgtaggcttaggtactccgtattgggactcagaagcaaga
ggtgccatttttggcttaacacgtggtactgaaaaagaacatttcattcgagctacttta
gaatcattatgttaccaaacacgtgatgttatggaagcaatgtctaaagattctggaatt
gatgttcaaagtctacgtgttgatggtggtgcagttaaaaataactttattatgcagttc
caagccgatattgttaacacgtcagttgaaagaccggaaatccaagaaactacagcttta
ggtgctgcttatttagctggattagctgtaggattctgggatagtaaagatgatatcgct
aagaactggaaattggaagaaaaatttgatccaaaaatggatgaaggcgaaagagaaaaa
ttatacagaggttggaaaaaagctgtagaagcaacacaagtttttaaaacagagtaa

DBGET integrated database retrieval system