KEGG   Staphylococcus argenteus: SAMSHR1132_11740Help
Entry
SAMSHR1132_11740  CDS       T01767                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
suh  Staphylococcus argenteus
Pathway
suh00260  Glycine, serine and threonine metabolism
suh00750  Vitamin B6 metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01230  Biosynthesis of amino acids
Module
suh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_11740
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAMSHR1132_11740
Enzymes [BR:suh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAMSHR1132_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCE59026
Position
1307035..1308096
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVDENTPKLTLNEGNTPLIHCENMSAMLGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPYRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHESKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWDKATNALSESNGLIDSVTDKEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKNSIIEYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagaatttaaggcacatttgccagtagacgaaaat
acacctaaattaactttaaatgaagggaatacaccacttattcattgtgaaaatatgtca
gcaatgttaggtattgatttatatgttaaatatgaaggtgccaatccaactgggtcattt
aaagatcgtggtatggtaatggctgtcactaaagctaaagagcaaggaaagaaaattgtt
atttgtgcttcaacaggaaatacgtcggcatccgccgctgcatatgcagcaagagctgga
ttaaaggcaatagttgttattccagaaggaaaaattgcattaggaaagttatctcaagcg
gtaatgtatggtgcagagatagtttcaattgaggggaattttgacgaagcattagagatt
gtgaaagaaattgctaaaagcggagaaattgagttagtgaactctgttaatccatacaga
attgaaggccaaaaaactggttcttttgaaattgtacaacaactagacggtgaagctcct
gacattttagcaattcctgtaggtaacgcaggtaatattacggcatattggaaaggtttt
aaagaatatcatgaatctaagggttctcaattacctaagatgtttggcttccaagctgaa
ggtgcatcaccaattgttcaaaataaagtcattaaaaacccggagacaattgcaactgct
attcgaatcggtaatcctgcaagctgggataaagcgacaaatgcgctgagtgaatcaaac
ggtttaattgatagtgttacagataaagaaatcttagaagcttatcaattaatgacaact
aaggaaggtgtctttagcgaaccagctagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaagttacctcaaggtaaaaaagttgttgcaatactaacaggcaatgga
ttaaaagaccctgatactgctatttcactattagataatccaattaagccattacctaat
gataagaatagtattattgaatatataaaaggagctttataa

DBGET integrated database retrieval system