KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_11740Help
Entry
SAMSHR1132_11740  CDS       T01767                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAMSHR1132_11740
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_11740
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAMSHR1132_11740
Enzymes [BR:suh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAMSHR1132_11740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1307035..1308096
Genome map
AA seq 353 aa AA seqDB search
MRRWQGLVEEFKAHLPVDENTPKLTLNEGNTPLIHCENMSAMLGIDLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKSGEIELVNSVNPYRIEGQKTGSFEIVQQLDGEAP
DILAIPVGNAGNITAYWKGFKEYHESKGSQLPKMFGFQAEGASPIVQNKVIKNPETIATA
IRIGNPASWDKATNALSESNGLIDSVTDKEILEAYQLMTTKEGVFSEPASNASIAGLIKL
HRQGKLPQGKKVVAILTGNGLKDPDTAISLLDNPIKPLPNDKNSIIEYIKGAL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggcaaggattagtagaagaatttaaggcacatttgccagtagacgaaaat
acacctaaattaactttaaatgaagggaatacaccacttattcattgtgaaaatatgtca
gcaatgttaggtattgatttatatgttaaatatgaaggtgccaatccaactgggtcattt
aaagatcgtggtatggtaatggctgtcactaaagctaaagagcaaggaaagaaaattgtt
atttgtgcttcaacaggaaatacgtcggcatccgccgctgcatatgcagcaagagctgga
ttaaaggcaatagttgttattccagaaggaaaaattgcattaggaaagttatctcaagcg
gtaatgtatggtgcagagatagtttcaattgaggggaattttgacgaagcattagagatt
gtgaaagaaattgctaaaagcggagaaattgagttagtgaactctgttaatccatacaga
attgaaggccaaaaaactggttcttttgaaattgtacaacaactagacggtgaagctcct
gacattttagcaattcctgtaggtaacgcaggtaatattacggcatattggaaaggtttt
aaagaatatcatgaatctaagggttctcaattacctaagatgtttggcttccaagctgaa
ggtgcatcaccaattgttcaaaataaagtcattaaaaacccggagacaattgcaactgct
attcgaatcggtaatcctgcaagctgggataaagcgacaaatgcgctgagtgaatcaaac
ggtttaattgatagtgttacagataaagaaatcttagaagcttatcaattaatgacaact
aaggaaggtgtctttagcgaaccagctagtaatgcttctattgcaggtttaattaaattg
catagacaaggtaagttacctcaaggtaaaaaagttgttgcaatactaacaggcaatgga
ttaaaagaccctgatactgctatttcactattagataatccaattaagccattacctaat
gataagaatagtattattgaatatataaaaggagctttataa

DBGET integrated database retrieval system