KEGG   Staphylococcus aureus subsp. aureus MSHR1132: SAMSHR1132_12150Help
Entry
SAMSHR1132_12150  CDS       T01767                                 

Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
suh  Staphylococcus aureus subsp. aureus MSHR1132
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAMSHR1132_12150
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_12150
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAMSHR1132_12150
Enzymes [BR:suh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAMSHR1132_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1357084..1358298
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGSPGVLHGTKMYLIQDEGGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSNEDIIVVTISGRGDKDMETIRQYMAERGLEND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatacggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgactccactgacatatgctgcatcatatactgaaagcttaggtggcgctaaaata
tatttgaaacgagaggatttaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgctcgctaaaagaatgggcaagaagaagcttgttgctgaaaccggtgcgggt
caacatggtgtagctagtgctactgttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaacgacaacaactcaatgtatttagaatggaattacttggt
gcgaaggttgttgctgttgaagatggtcaaggtacattatcggatgcagttaataaagct
ttgcaatattgggtgagtcatgtggatgacacacattatttattaggttctgcactaggt
ccagacccattcccaacgatagttagagattttcaaagtgtcattggtaaagaaataaaa
tcacaaatactgaaaaaagaaggacgacttccggatgcaatagtcgcatgtatcggtggt
ggctcaaatgcaatcggaacattttacccatttataaaagacgatgttgcgttatacggc
gttgaagcagcaggtcaaggcgaggatactgacaaacatgcacttgcaattggaaaaggt
tcaccaggtgtactacacggtacaaaaatgtatttaatccaagatgaaggtggtcaagtg
caacttgctcattctatatcagctggacttgattatcctggtatagggcctgaacattct
tattaccacgacataggaagagtaacgtttgaaaatgcaagtgatacacaagcaatgaat
gctttaattaactttacaaagcacgaaggtattatacctgcaatagaaagtgcacacgca
ctgagttatgttgaaagactagctcctacgatgtcgaatgaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggcagagcgaggt
cttgaaaatgactaa

DBGET integrated database retrieval system