KEGG   Staphylococcus argenteus: SAMSHR1132_12150Help
Entry
SAMSHR1132_12150  CDS       T01767                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
suh  Staphylococcus argenteus
Pathway
suh00260  Glycine, serine and threonine metabolism
suh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01130  Biosynthesis of antibiotics
suh01230  Biosynthesis of amino acids
Module
suh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_12150
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAMSHR1132_12150
Enzymes [BR:suh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAMSHR1132_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCE59067
UniProt: G7ZNB9
Position
1357084..1358298
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGSPGVLHGTKMYLIQDEGGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSNEDIIVVTISGRGDKDMETIRQYMAERGLEND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatacggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgactccactgacatatgctgcatcatatactgaaagcttaggtggcgctaaaata
tatttgaaacgagaggatttaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgctcgctaaaagaatgggcaagaagaagcttgttgctgaaaccggtgcgggt
caacatggtgtagctagtgctactgttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaacgacaacaactcaatgtatttagaatggaattacttggt
gcgaaggttgttgctgttgaagatggtcaaggtacattatcggatgcagttaataaagct
ttgcaatattgggtgagtcatgtggatgacacacattatttattaggttctgcactaggt
ccagacccattcccaacgatagttagagattttcaaagtgtcattggtaaagaaataaaa
tcacaaatactgaaaaaagaaggacgacttccggatgcaatagtcgcatgtatcggtggt
ggctcaaatgcaatcggaacattttacccatttataaaagacgatgttgcgttatacggc
gttgaagcagcaggtcaaggcgaggatactgacaaacatgcacttgcaattggaaaaggt
tcaccaggtgtactacacggtacaaaaatgtatttaatccaagatgaaggtggtcaagtg
caacttgctcattctatatcagctggacttgattatcctggtatagggcctgaacattct
tattaccacgacataggaagagtaacgtttgaaaatgcaagtgatacacaagcaatgaat
gctttaattaactttacaaagcacgaaggtattatacctgcaatagaaagtgcacacgca
ctgagttatgttgaaagactagctcctacgatgtcgaatgaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggcagagcgaggt
cttgaaaatgactaa

DBGET integrated database retrieval system